Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii tRNA-queuosine


LOCUS       XM_017140688            1190 bp    mRNA    linear   INV 09-DEC-2024
            alpha-mannosyltransferase (LOC108056734), mRNA.
ACCESSION   XM_017140688
VERSION     XM_017140688.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140688.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1190
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1190
                     /gene="LOC108056734"
                     /note="tRNA-queuosine alpha-mannosyltransferase; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056734"
     CDS             46..1146
                     /gene="LOC108056734"
                     /codon_start=1
                     /product="tRNA-queuosine alpha-mannosyltransferase"
                     /protein_id="XP_016996177.2"
                     /db_xref="GeneID:108056734"
                     /translation="MTSDKPHILIIEPFYGGSHKQLIDTLIEGLQSPPNYEIFSLPAK
                     KWHWRARTSALHFAQLIPLDHEYRVLFASSVLSLAELIGLRPDLAKCRKIVYFHENQL
                     VYPVREVKQRDCQYGYNEILTCLAADIVLFNSQFNCTSFLDNVQPFLKIQPDFRIKGI
                     REKIEKKCQVLYFPVRFQRFPSRSAHLEDRECLHLIWPHRWEHDKNPKLLAEALCELQ
                     ARQVDFKVTICGESYEEIPEPFADIQDKLGDKLLHFGHLEREDYVKTLLSGDIVISTA
                     DHEFFGVAMLEATYCGCYPLVPNKLVYPEIYPKDNLYNTSSALIKKLYNFCRNPKVFR
                     KHRDQFFETFHFDRFAAQELLPKYLDLFKVSL"
     misc_feature    64..561
                     /gene="LOC108056734"
                     /note="Domain of unknown function (DUF3524); Region:
                     DUF3524; pfam12038"
                     /db_xref="CDD:432280"
     misc_feature    <559..978
                     /gene="LOC108056734"
                     /note="glycosyltransferase family 1 and related proteins
                     with GTB topology; Region: Glycosyltransferase_GTB-type;
                     cd01635"
                     /db_xref="CDD:340816"
     polyA_site      1190
                     /gene="LOC108056734"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttggcagcg cggaaacccc ctttgtgtga acaggctata aaataatgac gtccgacaag
       61 ccgcacattt taattattga acccttttac gggggcagcc acaaacagct gattgacacc
      121 ctgatcgagg ggctccaatc cccaccgaac tacgagatct tcagccttcc cgccaagaaa
      181 tggcattgga gagcgcgcac atcggccctg catttcgccc agctgatccc cctcgatcac
      241 gagtaccggg tgctcttcgc cagctccgtt ctcagcctgg ccgaactgat tggcctgcgt
      301 ccggatctcg ccaagtgccg gaagatcgtg tactttcacg agaaccagct ggtctatccg
      361 gtgcgcgagg tgaagcagcg cgactgtcag tacggctaca atgagatcct cacctgccta
      421 gccgccgaca ttgtgctctt caactcgcag ttcaactgca catcatttct ggacaatgtg
      481 cagcccttcc tgaaaatcca gccagacttt aggataaaag ggattcggga gaaaattgag
      541 aagaaatgcc aggtgctgta ctttcccgtt cggtttcagc gatttcctag caggagtgcc
      601 catctggagg atcgtgagtg cctgcatctc atttggccac atcgctggga gcacgacaag
      661 aatcccaagc tattggccga ggcgctttgc gagcttcagg cgcgccaagt ggacttcaag
      721 gtgaccattt gcggcgagag ctacgaggag attccagagc ccttcgccga tatccaggat
      781 aaactgggag ataagctgct gcactttggc cacctggaac gggaggatta tgtaaagacc
      841 ctgctctccg gcgacattgt aatctcaacc gctgaccacg aattctttgg agtggccatg
      901 ctggaggcca cttactgcgg ctgctatccc ctggtgccca ataaactggt ttacccggag
      961 atctatccca aggacaacct gtacaacacc tccagcgccc tgatcaaaaa gctctacaac
     1021 ttctgtagaa acccaaaagt ctttcgcaag caccgcgatc aattctttga aaccttccat
     1081 ttcgatcgct ttgcggcgca ggaacttctt ccaaaatatc tagacttatt caaggtttca
     1141 ctttaagcat atttatttat taaatatacg aaaaaaatgg gttacaataa