Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140688 1190 bp mRNA linear INV 09-DEC-2024 alpha-mannosyltransferase (LOC108056734), mRNA. ACCESSION XM_017140688 VERSION XM_017140688.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140688.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1190 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1190 /gene="LOC108056734" /note="tRNA-queuosine alpha-mannosyltransferase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056734" CDS 46..1146 /gene="LOC108056734" /codon_start=1 /product="tRNA-queuosine alpha-mannosyltransferase" /protein_id="XP_016996177.2" /db_xref="GeneID:108056734" /translation="MTSDKPHILIIEPFYGGSHKQLIDTLIEGLQSPPNYEIFSLPAK KWHWRARTSALHFAQLIPLDHEYRVLFASSVLSLAELIGLRPDLAKCRKIVYFHENQL VYPVREVKQRDCQYGYNEILTCLAADIVLFNSQFNCTSFLDNVQPFLKIQPDFRIKGI REKIEKKCQVLYFPVRFQRFPSRSAHLEDRECLHLIWPHRWEHDKNPKLLAEALCELQ ARQVDFKVTICGESYEEIPEPFADIQDKLGDKLLHFGHLEREDYVKTLLSGDIVISTA DHEFFGVAMLEATYCGCYPLVPNKLVYPEIYPKDNLYNTSSALIKKLYNFCRNPKVFR KHRDQFFETFHFDRFAAQELLPKYLDLFKVSL" misc_feature 64..561 /gene="LOC108056734" /note="Domain of unknown function (DUF3524); Region: DUF3524; pfam12038" /db_xref="CDD:432280" misc_feature <559..978 /gene="LOC108056734" /note="glycosyltransferase family 1 and related proteins with GTB topology; Region: Glycosyltransferase_GTB-type; cd01635" /db_xref="CDD:340816" polyA_site 1190 /gene="LOC108056734" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttggcagcg cggaaacccc ctttgtgtga acaggctata aaataatgac gtccgacaag 61 ccgcacattt taattattga acccttttac gggggcagcc acaaacagct gattgacacc 121 ctgatcgagg ggctccaatc cccaccgaac tacgagatct tcagccttcc cgccaagaaa 181 tggcattgga gagcgcgcac atcggccctg catttcgccc agctgatccc cctcgatcac 241 gagtaccggg tgctcttcgc cagctccgtt ctcagcctgg ccgaactgat tggcctgcgt 301 ccggatctcg ccaagtgccg gaagatcgtg tactttcacg agaaccagct ggtctatccg 361 gtgcgcgagg tgaagcagcg cgactgtcag tacggctaca atgagatcct cacctgccta 421 gccgccgaca ttgtgctctt caactcgcag ttcaactgca catcatttct ggacaatgtg 481 cagcccttcc tgaaaatcca gccagacttt aggataaaag ggattcggga gaaaattgag 541 aagaaatgcc aggtgctgta ctttcccgtt cggtttcagc gatttcctag caggagtgcc 601 catctggagg atcgtgagtg cctgcatctc atttggccac atcgctggga gcacgacaag 661 aatcccaagc tattggccga ggcgctttgc gagcttcagg cgcgccaagt ggacttcaag 721 gtgaccattt gcggcgagag ctacgaggag attccagagc ccttcgccga tatccaggat 781 aaactgggag ataagctgct gcactttggc cacctggaac gggaggatta tgtaaagacc 841 ctgctctccg gcgacattgt aatctcaacc gctgaccacg aattctttgg agtggccatg 901 ctggaggcca cttactgcgg ctgctatccc ctggtgccca ataaactggt ttacccggag 961 atctatccca aggacaacct gtacaacacc tccagcgccc tgatcaaaaa gctctacaac 1021 ttctgtagaa acccaaaagt ctttcgcaag caccgcgatc aattctttga aaccttccat 1081 ttcgatcgct ttgcggcgca ggaacttctt ccaaaatatc tagacttatt caaggtttca 1141 ctttaagcat atttatttat taaatatacg aaaaaaatgg gttacaataa