Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140650 945 bp mRNA linear INV 09-DEC-2024 (ND-24), mRNA. ACCESSION XM_017140650 VERSION XM_017140650.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140650.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..945 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..945 /gene="ND-24" /note="NADH dehydrogenase ubiquinone; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108056721" CDS 125..853 /gene="ND-24" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial" /protein_id="XP_016996139.2" /db_xref="GeneID:108056721" /translation="MLTNCASKTLAAVRANIRAIATGSARASDNLFVHRDTPEDNPNI PFEFTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPN MRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILEQCKKQLNIGVGDTTKDK QFTISEVECLGACVNAPMVAINDDYYEDLTAKDMQDILNDLKAGKISPPGPRNGRFAS EPKGEPTSLSEEPKGPGFGLQAGL" misc_feature 290..730 /gene="ND-24" /note="Thioredoxin-like [2Fe-2S] ferredoxin; Region: 2Fe-2S_thioredx; pfam01257" /db_xref="CDD:460139" polyA_site 945 /gene="ND-24" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcccccccct gaaatcagct gtgagcggtg cttgttaaaa aaaaaaaaaa actgacagca 61 ggcaacgaac ttcacataac atcaaagcca attttccgct tttcaatatt ttggaaacgc 121 cagaatgctg acgaactgtg cctccaagac gctggccgct gtgcgcgcca acattcgggc 181 cattgccacc ggaagtgccc gggccagcga taatctgttc gtgcatcggg acacgccgga 241 ggacaacccg aacatcccgt tcgagttcac cgcggagaac aagaagcgcg tggaggcgat 301 actgagcatc tatccggagg gccacaagcg cggcgccatg atccctttgc tcgatctcgc 361 ccagcgccaa tacggctggc tacccatctc cgccatgcac aaggtggccg agatcttgca 421 gctgcccaat atgcgcgtct acgaggtggc caccttctac acgatgttca tgcgcaagcc 481 caccggcaag tatcacatcc aggtgtgcac caccacgccc tgctggctgc gcggctccga 541 cgacatcctc gagcagtgca agaagcagct gaacatcggc gtcggcgaca ccaccaagga 601 caagcagttc accatctcgg aggtcgagtg cctgggcgcc tgcgtcaacg cgcccatggt 661 ggcgatcaac gatgactact atgaggatct gacggccaag gacatgcagg acatcctgaa 721 cgacctgaag gcgggcaaaa tatcgccgcc cggtcctcgc aacggtcgct ttgccagcga 781 gccgaagggc gagcccactt ccctgagcga ggagcccaag ggtcctggct ttggcctgca 841 ggccggcctc tagatttctc cagaggattg gctgcatgga gcgcagaacc tatcactgat 901 tgtcgaacga aagttaaata aatattaagc aactcttaga ggtca