Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH dehydrogenase ubiquinone


LOCUS       XM_017140650             945 bp    mRNA    linear   INV 09-DEC-2024
            (ND-24), mRNA.
ACCESSION   XM_017140650
VERSION     XM_017140650.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140650.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..945
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..945
                     /gene="ND-24"
                     /note="NADH dehydrogenase ubiquinone; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108056721"
     CDS             125..853
                     /gene="ND-24"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] flavoprotein 2,
                     mitochondrial"
                     /protein_id="XP_016996139.2"
                     /db_xref="GeneID:108056721"
                     /translation="MLTNCASKTLAAVRANIRAIATGSARASDNLFVHRDTPEDNPNI
                     PFEFTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPN
                     MRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILEQCKKQLNIGVGDTTKDK
                     QFTISEVECLGACVNAPMVAINDDYYEDLTAKDMQDILNDLKAGKISPPGPRNGRFAS
                     EPKGEPTSLSEEPKGPGFGLQAGL"
     misc_feature    290..730
                     /gene="ND-24"
                     /note="Thioredoxin-like [2Fe-2S] ferredoxin; Region:
                     2Fe-2S_thioredx; pfam01257"
                     /db_xref="CDD:460139"
     polyA_site      945
                     /gene="ND-24"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcccccccct gaaatcagct gtgagcggtg cttgttaaaa aaaaaaaaaa actgacagca
       61 ggcaacgaac ttcacataac atcaaagcca attttccgct tttcaatatt ttggaaacgc
      121 cagaatgctg acgaactgtg cctccaagac gctggccgct gtgcgcgcca acattcgggc
      181 cattgccacc ggaagtgccc gggccagcga taatctgttc gtgcatcggg acacgccgga
      241 ggacaacccg aacatcccgt tcgagttcac cgcggagaac aagaagcgcg tggaggcgat
      301 actgagcatc tatccggagg gccacaagcg cggcgccatg atccctttgc tcgatctcgc
      361 ccagcgccaa tacggctggc tacccatctc cgccatgcac aaggtggccg agatcttgca
      421 gctgcccaat atgcgcgtct acgaggtggc caccttctac acgatgttca tgcgcaagcc
      481 caccggcaag tatcacatcc aggtgtgcac caccacgccc tgctggctgc gcggctccga
      541 cgacatcctc gagcagtgca agaagcagct gaacatcggc gtcggcgaca ccaccaagga
      601 caagcagttc accatctcgg aggtcgagtg cctgggcgcc tgcgtcaacg cgcccatggt
      661 ggcgatcaac gatgactact atgaggatct gacggccaag gacatgcagg acatcctgaa
      721 cgacctgaag gcgggcaaaa tatcgccgcc cggtcctcgc aacggtcgct ttgccagcga
      781 gccgaagggc gagcccactt ccctgagcga ggagcccaag ggtcctggct ttggcctgca
      841 ggccggcctc tagatttctc cagaggattg gctgcatgga gcgcagaacc tatcactgat
      901 tgtcgaacga aagttaaata aatattaagc aactcttaga ggtca