PREDICTED: Drosophila takahashii melanization protease 1-like

LOCUS       XM_017140635            1066 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056712), mRNA.
ACCESSION   XM_017140635
VERSION     XM_017140635.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140635.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1066
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1066
                     /gene="LOC108056712"
                     /note="melanization protease 1-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108056712"
     CDS             37..1065
                     /gene="LOC108056712"
                     /codon_start=1
                     /product="melanization protease 1-like"
                     /protein_id="XP_016996124.2"
                     /db_xref="GeneID:108056712"
                     /translation="MVLRPGTFTFALFLCGVFLASCWAKPRLHFGICHGPERGKCLPI
                     EECREEEGFHQAKDSAECFSTICCLSKRPEYPQSIKNYCHHDLRPHISNGQVSEMREF
                     PWMAMLLYGNRVLPKCGGSLVAAKWVLTAAHCVPSENDQEKLHLVRLGVWDVRLENCQ
                     GLNCTPPPEDYPIERAIVHEMYRPLDKTGSNLEKYSNDIALLLLSRTVIYTQFIQPIC
                     LPPAFTASRRDVYVDYKLTIAGWGRTSGSSEATSQVKIKATVNGWSMESCKRLYAGVS
                     GGQMCTGGGAARRGSCFGDSGGPVMDGNQLVGIISLGGSECGSDSTPMVVTRVDTYLN
                     WLKRHIPQ"
     misc_feature    307..1053
                     /gene="LOC108056712"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    307..309
                     /gene="LOC108056712"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(433..435,628..630,922..924)
                     /gene="LOC108056712"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(904..906,967..969,976..978)
                     /gene="LOC108056712"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 aatgctctcc gcgtctattg attcagattc aaagctatgg ttctccgacc cggaaccttt
       61 acctttgcct tgttcctctg cggagtgttt ttggccagct gttgggcaaa acccaggctg
      121 cactttggta tctgccatgg acccgaaagg ggcaagtgcc tgcccatcga ggagtgccgc
      181 gaggaggagg gttttcacca ggccaaggac tcggccgagt gcttcagtac gatttgttgc
      241 ctctcgaagc gaccggagta cccgcaatcc ataaagaact actgccacca cgatctgcgg
      301 ccccacatct ccaatggcca ggtgtccgag atgcgggaat tcccctggat ggccatgttg
      361 ctgtacggca atcgggtgct gcccaagtgc ggtggctccc tggtggccgc caagtgggtc
      421 ctgaccgccg cccattgtgt gccgagcgag aatgaccagg agaagctgca tctcgttcgg
      481 ctgggcgtgt gggatgttcg cctggagaat tgccagggct tgaactgcac accgccgccc
      541 gaggattacc ccatcgagcg ggccatcgtt cacgagatgt atcgcccttt ggacaagaca
      601 ggatccaatc tagagaagta ctccaacgac attgccctgc tgcttctttc ccgcactgtc
      661 atctacacgc agttcatcca gcccatctgc ctgccgccgg cgttcactgc ctcccgccgc
      721 gatgtctatg tagactataa actgaccatt gcgggatggg gtcgcaccag tggctcctcg
      781 gaggccacca gccaggtgaa gatcaaggcg acggttaatg gctggtccat ggagagctgc
      841 aaaaggctgt acgccggcgt gagtggtggg cagatgtgca ccggaggagg ggccgccagg
      901 aggggcagct gcttcggcga ctccggcggc ccggtgatgg acggcaacca actggtgggc
      961 atcatctcgc tgggcggctc tgagtgcggt tccgacagca cacccatggt ggtcacgcgg
     1021 gtggatacct atttaaactg gctgaagcgg cacatccctc aataat