Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140634 1690 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017140634 VERSION XM_017140634.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140634.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1690 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1690 /gene="Ucp4A" /note="Uncoupling protein 4A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056711" CDS 453..1481 /gene="Ucp4A" /codon_start=1 /product="mitochondrial uncoupling protein 4" /protein_id="XP_016996123.2" /db_xref="GeneID:108056711" /translation="MAAKTDESSPAVAPVAGGSSSPVPSSGRHQLRPVKFDYADSFAC TYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAQSAGKSNMQYRGMVATAFGIAREE GALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTENGSQALPVWKSALCGVTAGAVA QWLASPADLVKVQIQMEGRRRLMGEKPRVHSAGHAFREIVQRGGVKGLWKGSIPNVQR AALVNLGDLTTYDTIKHLIMDRLQMPDCHTVHVLASICAGFVAAIMGTPADVVKTRIM NQPTDEKGRGLLYRGSVDCLRQTVGREGFVALYKGFLPCWIRMAPWSLTFWLSFEQIR KMIGASGY" misc_feature 573..872 /gene="Ucp4A" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 882..1175 /gene="Ucp4A" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" misc_feature 1200..1466 /gene="Ucp4A" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:395101" polyA_site 1690 /gene="Ucp4A" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccctggcctg catcgctttt gtttttgtgg cctttttgtt ttattgcgct gataactaca 61 ggttttatac aatagcctca gacatatagc ccccgatatc tggcaggata taaatagagc 121 ggcttcgcag gcggggtgga caaacatgat tagccgccca gcgcgtgcca gcgagtgttt 181 tataagagcg cgattctgat tttgatttgc ttttgccatt gttattgtta ttgttattgc 241 gggcaaagaa aaaggaaagc aaaagccaaa agccattgtg ttgccaaaac gttgttgtta 301 tgtaaatgca cggaagcaga acgttggtca cggacacaaa ggcatcccca accgcatccg 361 gaatccgaat ccgaatccgg aatcccagag aggtcggagc acccgctcgc atcacgcgat 421 tgtgtgaaag tttcacctgt tcagactctt agatggcagc caaaacggat gaatcctcgc 481 cagcagtggc tcctgtcgcc ggcgggagca gcagcccagt gccctccagt ggacgccacc 541 agttgcgacc cgtgaagttc gactacgcgg actcgtttgc ctgcacctac atcgtttccg 601 tggtggccgc ctccatcgcc gagctggcca cctatcccct ggacctcacg aagacgcgtc 661 tgcagatcca gggcgaggga gccgcccagt ccgccggaaa gtccaatatg caataccgcg 721 gcatggtggc caccgccttc gggattgcgc gcgaggaggg cgccctgaag ctgtggcagg 781 gcgtgacgcc ggcgctctac cgacacgtcg tctatagcgg cgtgaggatc tgcagctacg 841 acctgatgcg caaggagttc accgagaacg gcagccaggc gctgcccgtt tggaagtccg 901 ccctgtgtgg cgtcacagcg ggcgccgttg cccagtggct ggcctcgccg gctgatttgg 961 ttaaggtgca gatccaaatg gagggacgcc ggcgactgat gggcgagaag ccaagggtcc 1021 actcagcggg ccacgccttc cgcgagatcg tccagcgcgg cggagtgaag ggcctgtgga 1081 agggcagcat accgaatgtg cagcgggcgg cgctggtcaa cctgggcgac ctgaccacct 1141 acgacaccat caagcacctg atcatggacc gcctgcagat gcccgactgc cacaccgttc 1201 atgtgctggc ctccatttgc gcgggcttcg tggcggcgat catgggcacg ccggcggatg 1261 tggtgaagac aaggattatg aaccagccga cggatgagaa ggggcggggc ctgctgtacc 1321 gcggatccgt ggactgcctg cggcaaacgg tgggcaggga gggctttgtg gccttgtaca 1381 agggcttcct gccctgctgg atacgcatgg cgccctggtc gctcaccttc tggctgtcct 1441 tcgagcagat ccgcaagatg atcggtgcct ccggctacta aatctgtgtt tttcgtacat 1501 gtttgttcaa ttatcccgcc tcaaagtcgg tttaaatccc taattcctaa tagcgaagct 1561 ctgcccccgt tttaatctgt tttgccagcg ggttttcaat cttttgggct catttctcct 1621 atcttttgtt attgttgttg ccttgagaaa atcaaaaacc ttacaataaa gcgagaaact 1681 tgttatttca