Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fibrinogen-like protein 1


LOCUS       XM_017140609            1347 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056700), mRNA.
ACCESSION   XM_017140609
VERSION     XM_017140609.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017140609.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1347
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1347
                     /gene="LOC108056700"
                     /note="fibrinogen-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108056700"
     CDS             1..1347
                     /gene="LOC108056700"
                     /codon_start=1
                     /product="fibrinogen-like protein 1"
                     /protein_id="XP_016996098.2"
                     /db_xref="GeneID:108056700"
                     /translation="MNFGWLSLCVSLWLLKSLSLAAADSLDPQCNDQCVDLLSPLMDH
                     LQQLRELSDTNGELKDMVNTRELANKDLKSQLTIAERDLGSQERVLTAQTDEIKYQAQ
                     VIAFKDDKIQTLTKDFNEVKDKLEIVNRHLKSQDATISDLTKQLNNQNEQLKDQNKLI
                     NQVNSLTQREKSLEGRLASAMSTNDLKEKALERKDEQIKKQNQQISIKENQISGLDRQ
                     VKSIDEKLDEVTDELLKANGTDRCPTNKPSGIYKIKPSGLKHFAVPCNTTGWMTIQKR
                     FNGSVDFNRSWQEYRNGFGDINGEFFLGLEKVHQMTSAVPHELYIRLGTVYGATSFIH
                     YDNFQIGSESESYMLKSLGVHYGPAGDSLKYHLHDKFSTYDRDNDLARGNCAVDHAGG
                     WWYKACCISTLNGKFYSKGVKGNGPHGIQWASWQNYDYDLSLTLSEMMIRPKSAKN"
     misc_feature    <136..>699
                     /gene="LOC108056700"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
     misc_feature    736..1332
                     /gene="LOC108056700"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    1042..1044
                     /gene="LOC108056700"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(1129..1131,1135..1137,1141..1143)
                     /gene="LOC108056700"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(1153..1155,1162..1167,1192..1197)
                     /gene="LOC108056700"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
ORIGIN      
        1 atgaattttg gctggttgtc gctttgtgtg tccttgtggc tcctgaagtc attatccttg
       61 gcggccgcag attcactgga tccacagtgc aatgatcagt gtgtggacct cttgtcgccc
      121 ttgatggatc atctccaaca gcttcgggaa ttatccgata cgaatggcga actaaaggac
      181 atggtgaata ccagggaact ggccaacaag gacctgaaaa gccagctaac tattgctgaa
      241 cgagatttgg gatcccagga aagagtatta actgcccaaa ctgatgaaat caagtatcag
      301 gctcaagtga tcgcctttaa agatgataaa atacaaactt tgactaaaga tttcaatgaa
      361 gtgaaggata aattggaaat cgtaaaccgt cacttgaaaa gccaagatgc cacaatcagt
      421 gatctgacca aacagttgaa caatcaaaat gaacagttga aggaccaaaa taaactaatc
      481 aaccaggtga atagtttgac gcaaagggag aaaagcttgg aaggcaggtt ggcaagtgcc
      541 atgtccacca acgacctcaa agagaaggct ctcgagagga aggatgagca gattaagaag
      601 caaaatcaac agatttcgat caaggaaaac caaatcagcg gattggacag gcaagtaaag
      661 tctattgacg agaagctcga tgaggtaacc gatgaactgc tgaaggcgaa tggaacggac
      721 aggtgtccca ctaacaaacc aagtggcatt tacaagatca agccaagtgg tctgaagcac
      781 tttgcagttc cctgcaacac aaccggttgg atgacgatcc agaagcgttt caacggttcc
      841 gtggatttca atagatcctg gcaggaatat aggaatgggt tcggtgatat caatggcgag
      901 ttcttcctgg gactggagaa agtccaccag atgacctcgg ctgtgccgca cgagctttac
      961 attcgactag gcacagtcta cggagccacc agctttattc actacgacaa cttccagatc
     1021 ggaagcgaat ccgaatcgta tatgctgaaa tcgctgggtg ttcactatgg cccagctggg
     1081 gattccctga agtaccattt gcacgacaag ttcagcacct acgatcgcga taacgatctg
     1141 gccaggggca actgcgctgt ggaccacgca ggtggatggt ggtacaaggc ctgttgcatt
     1201 agcaccctga atggcaaatt ctacagcaag ggcgtcaagg gcaacggtcc gcacggaatc
     1261 caatgggcct cttggcaaaa ctacgactac gatctgtcgc ttactctttc agaaatgatg
     1321 attaggccta aaagtgccaa aaactaa