Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140609 1347 bp mRNA linear INV 09-DEC-2024 (LOC108056700), mRNA. ACCESSION XM_017140609 VERSION XM_017140609.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017140609.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1347 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1347 /gene="LOC108056700" /note="fibrinogen-like protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108056700" CDS 1..1347 /gene="LOC108056700" /codon_start=1 /product="fibrinogen-like protein 1" /protein_id="XP_016996098.2" /db_xref="GeneID:108056700" /translation="MNFGWLSLCVSLWLLKSLSLAAADSLDPQCNDQCVDLLSPLMDH LQQLRELSDTNGELKDMVNTRELANKDLKSQLTIAERDLGSQERVLTAQTDEIKYQAQ VIAFKDDKIQTLTKDFNEVKDKLEIVNRHLKSQDATISDLTKQLNNQNEQLKDQNKLI NQVNSLTQREKSLEGRLASAMSTNDLKEKALERKDEQIKKQNQQISIKENQISGLDRQ VKSIDEKLDEVTDELLKANGTDRCPTNKPSGIYKIKPSGLKHFAVPCNTTGWMTIQKR FNGSVDFNRSWQEYRNGFGDINGEFFLGLEKVHQMTSAVPHELYIRLGTVYGATSFIH YDNFQIGSESESYMLKSLGVHYGPAGDSLKYHLHDKFSTYDRDNDLARGNCAVDHAGG WWYKACCISTLNGKFYSKGVKGNGPHGIQWASWQNYDYDLSLTLSEMMIRPKSAKN" misc_feature <136..>699 /gene="LOC108056700" /note="chromosome segregation protein SMC, common bacterial type; Region: SMC_prok_B; TIGR02168" /db_xref="CDD:274008" misc_feature 736..1332 /gene="LOC108056700" /note="Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular...; Region: FReD; cd00087" /db_xref="CDD:238040" misc_feature 1042..1044 /gene="LOC108056700" /note="gamma-gamma dimer interface [polypeptide binding]; other site" /db_xref="CDD:238040" misc_feature order(1129..1131,1135..1137,1141..1143) /gene="LOC108056700" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238040" misc_feature order(1153..1155,1162..1167,1192..1197) /gene="LOC108056700" /note="polymerization pocket [active]" /db_xref="CDD:238040" ORIGIN 1 atgaattttg gctggttgtc gctttgtgtg tccttgtggc tcctgaagtc attatccttg 61 gcggccgcag attcactgga tccacagtgc aatgatcagt gtgtggacct cttgtcgccc 121 ttgatggatc atctccaaca gcttcgggaa ttatccgata cgaatggcga actaaaggac 181 atggtgaata ccagggaact ggccaacaag gacctgaaaa gccagctaac tattgctgaa 241 cgagatttgg gatcccagga aagagtatta actgcccaaa ctgatgaaat caagtatcag 301 gctcaagtga tcgcctttaa agatgataaa atacaaactt tgactaaaga tttcaatgaa 361 gtgaaggata aattggaaat cgtaaaccgt cacttgaaaa gccaagatgc cacaatcagt 421 gatctgacca aacagttgaa caatcaaaat gaacagttga aggaccaaaa taaactaatc 481 aaccaggtga atagtttgac gcaaagggag aaaagcttgg aaggcaggtt ggcaagtgcc 541 atgtccacca acgacctcaa agagaaggct ctcgagagga aggatgagca gattaagaag 601 caaaatcaac agatttcgat caaggaaaac caaatcagcg gattggacag gcaagtaaag 661 tctattgacg agaagctcga tgaggtaacc gatgaactgc tgaaggcgaa tggaacggac 721 aggtgtccca ctaacaaacc aagtggcatt tacaagatca agccaagtgg tctgaagcac 781 tttgcagttc cctgcaacac aaccggttgg atgacgatcc agaagcgttt caacggttcc 841 gtggatttca atagatcctg gcaggaatat aggaatgggt tcggtgatat caatggcgag 901 ttcttcctgg gactggagaa agtccaccag atgacctcgg ctgtgccgca cgagctttac 961 attcgactag gcacagtcta cggagccacc agctttattc actacgacaa cttccagatc 1021 ggaagcgaat ccgaatcgta tatgctgaaa tcgctgggtg ttcactatgg cccagctggg 1081 gattccctga agtaccattt gcacgacaag ttcagcacct acgatcgcga taacgatctg 1141 gccaggggca actgcgctgt ggaccacgca ggtggatggt ggtacaaggc ctgttgcatt 1201 agcaccctga atggcaaatt ctacagcaag ggcgtcaagg gcaacggtcc gcacggaatc 1261 caatgggcct cttggcaaaa ctacgactac gatctgtcgc ttactctttc agaaatgatg 1321 attaggccta aaagtgccaa aaactaa