Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii alpha-ketoglutarate-dependent


LOCUS       XM_017140564            1090 bp    mRNA    linear   INV 09-DEC-2024
            dioxygenase AlkB (AlkB), transcript variant X2, mRNA.
ACCESSION   XM_017140564
VERSION     XM_017140564.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140564.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1090
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1090
                     /gene="AlkB"
                     /note="alpha-ketoglutarate-dependent dioxygenase AlkB;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon."
                     /db_xref="GeneID:108056682"
     CDS             195..1034
                     /gene="AlkB"
                     /codon_start=1
                     /product="nucleic acid dioxygenase ALKBH1 isoform X2"
                     /protein_id="XP_016996053.2"
                     /db_xref="GeneID:108056682"
                     /translation="MPGVKSPSDWRSYALTHHPGIIIIRNPFTERGRRYWIARCLRDY
                     PRTPNIVNLNERLFDDSVRSDWWKQLSLCRDRAEFQRMKSAMRWTTFGYHHNWDTKHY
                     EERMQSQFPEDLGSLCRLFASTLGYCDFKPEAAIVNYYPVGSTLSGHTDHSEPNQTAP
                     LFSFSFGQTAIFLIGGRTLEEKPTAVYLQCGDVMIMSGESRLCYHAVPRIMKTRRPGN
                     SPLTNEDADDADHDTHLVDMGLFQNVGDASFWEPFSNYIDDSRININVRQVLNIGDLK
                     LGP"
     misc_feature    252..863
                     /gene="AlkB"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy_2; pfam13532"
                     /db_xref="CDD:433285"
ORIGIN      
        1 agtttgttaa atttattgtt taaattgtat atattattta tgaaatatgt ttaagttagc
       61 ttttaagcag tacaaggcga aaagtggcag tcccgatcta acgggcgtga tcaatgtgga
      121 tgatcacgat ctgcgaaacg ataatgtaga tcgttcaacg gttggatatc agcgatggaa
      181 gagttattca gaccatgccc ggcgttaagt cacccagtga ttggcgatcc tacgcactta
      241 ctcatcatcc cggcattatc attatccgga acccctttac tgagcgcggt cggcgctact
      301 ggattgcgcg atgtctacgc gactatccgc ggaccccgaa catcgttaat ttaaatgaaa
      361 gactcttcga tgattcagtc agatcggact ggtggaaaca gcttagtctg tgccgcgaca
      421 gggcggaatt ccagcgaatg aaatcagcga tgcgctggac gacattcgga tatcaccaca
      481 actgggacac gaagcactac gaggagcgga tgcagtcaca gtttccagag gacttgggca
      541 gtctgtgccg gttgttcgcg tccaccttgg gctactgtga ctttaagccg gaagccgcta
      601 tcgtgaacta ctatccagtg ggcagtactt tgtcgggcca cacggatcac tctgagccca
      661 atcaaacggc cccgctattc tcgtttagct ttggtcagac cgcaattttt ctgatcggtg
      721 gaaggacttt ggaggaaaaa ccaaccgcag tctaccttca gtgtggggac gttatgataa
      781 tgtccggaga gtcacggtta tgctatcacg cagttccccg aattatgaag acccggagac
      841 ctgggaattc tccgctgaca aatgaagatg ccgatgatgc tgatcatgac acccatcttg
      901 tggatatggg tttgtttcaa aatgtagggg atgccagttt ttgggaacct ttttcgaatt
      961 atattgacga ttcgcgtatt aatattaatg tacgacaagt gttgaacata ggagatttaa
     1021 aattgggccc ttaattgtta tttggtttgt aaaataggag tttgaaattt gaaaaattgt
     1081 aaaaataaat