Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140564 1090 bp mRNA linear INV 09-DEC-2024 dioxygenase AlkB (AlkB), transcript variant X2, mRNA. ACCESSION XM_017140564 VERSION XM_017140564.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140564.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1090 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1090 /gene="AlkB" /note="alpha-ketoglutarate-dependent dioxygenase AlkB; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108056682" CDS 195..1034 /gene="AlkB" /codon_start=1 /product="nucleic acid dioxygenase ALKBH1 isoform X2" /protein_id="XP_016996053.2" /db_xref="GeneID:108056682" /translation="MPGVKSPSDWRSYALTHHPGIIIIRNPFTERGRRYWIARCLRDY PRTPNIVNLNERLFDDSVRSDWWKQLSLCRDRAEFQRMKSAMRWTTFGYHHNWDTKHY EERMQSQFPEDLGSLCRLFASTLGYCDFKPEAAIVNYYPVGSTLSGHTDHSEPNQTAP LFSFSFGQTAIFLIGGRTLEEKPTAVYLQCGDVMIMSGESRLCYHAVPRIMKTRRPGN SPLTNEDADDADHDTHLVDMGLFQNVGDASFWEPFSNYIDDSRININVRQVLNIGDLK LGP" misc_feature 252..863 /gene="AlkB" /note="2OG-Fe(II) oxygenase superfamily; Region: 2OG-FeII_Oxy_2; pfam13532" /db_xref="CDD:433285" ORIGIN 1 agtttgttaa atttattgtt taaattgtat atattattta tgaaatatgt ttaagttagc 61 ttttaagcag tacaaggcga aaagtggcag tcccgatcta acgggcgtga tcaatgtgga 121 tgatcacgat ctgcgaaacg ataatgtaga tcgttcaacg gttggatatc agcgatggaa 181 gagttattca gaccatgccc ggcgttaagt cacccagtga ttggcgatcc tacgcactta 241 ctcatcatcc cggcattatc attatccgga acccctttac tgagcgcggt cggcgctact 301 ggattgcgcg atgtctacgc gactatccgc ggaccccgaa catcgttaat ttaaatgaaa 361 gactcttcga tgattcagtc agatcggact ggtggaaaca gcttagtctg tgccgcgaca 421 gggcggaatt ccagcgaatg aaatcagcga tgcgctggac gacattcgga tatcaccaca 481 actgggacac gaagcactac gaggagcgga tgcagtcaca gtttccagag gacttgggca 541 gtctgtgccg gttgttcgcg tccaccttgg gctactgtga ctttaagccg gaagccgcta 601 tcgtgaacta ctatccagtg ggcagtactt tgtcgggcca cacggatcac tctgagccca 661 atcaaacggc cccgctattc tcgtttagct ttggtcagac cgcaattttt ctgatcggtg 721 gaaggacttt ggaggaaaaa ccaaccgcag tctaccttca gtgtggggac gttatgataa 781 tgtccggaga gtcacggtta tgctatcacg cagttccccg aattatgaag acccggagac 841 ctgggaattc tccgctgaca aatgaagatg ccgatgatgc tgatcatgac acccatcttg 901 tggatatggg tttgtttcaa aatgtagggg atgccagttt ttgggaacct ttttcgaatt 961 atattgacga ttcgcgtatt aatattaatg tacgacaagt gttgaacata ggagatttaa 1021 aattgggccc ttaattgtta tttggtttgt aaaataggag tttgaaattt gaaaaattgt 1081 aaaaataaat