Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140563 1130 bp mRNA linear INV 09-DEC-2024 dioxygenase AlkB (AlkB), transcript variant X1, mRNA. ACCESSION XM_017140563 VERSION XM_017140563.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140563.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1130 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1130 /gene="AlkB" /note="alpha-ketoglutarate-dependent dioxygenase AlkB; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056682" CDS 91..1074 /gene="AlkB" /codon_start=1 /product="nucleic acid dioxygenase ALKBH1 isoform X1" /protein_id="XP_016996052.2" /db_xref="GeneID:108056682" /translation="MFKLAFKQYKAKSGSPDLTGVINVDDHDLRNDNIVQRLDISDGR VIQTMPGVKSPSDWRSYALTHHPGIIIIRNPFTERGRRYWIARCLRDYPRTPNIVNLN ERLFDDSVRSDWWKQLSLCRDRAEFQRMKSAMRWTTFGYHHNWDTKHYEERMQSQFPE DLGSLCRLFASTLGYCDFKPEAAIVNYYPVGSTLSGHTDHSEPNQTAPLFSFSFGQTA IFLIGGRTLEEKPTAVYLQCGDVMIMSGESRLCYHAVPRIMKTRRPGNSPLTNEDADD ADHDTHLVDMGLFQNVGDASFWEPFSNYIDDSRININVRQVLNIGDLKLGP" misc_feature 292..903 /gene="AlkB" /note="2OG-Fe(II) oxygenase superfamily; Region: 2OG-FeII_Oxy_2; pfam13532" /db_xref="CDD:433285" ORIGIN 1 tgaatagcat ttcagatctc ccctaacgca gtcacactac ctgtagtttg ttaaatttat 61 tgtttaaatt gtatatatta tttatgaaat atgtttaagt tagcttttaa gcagtacaag 121 gcgaaaagtg gcagtcccga tctaacgggc gtgatcaatg tggatgatca cgatctgcga 181 aacgataata tcgttcaacg gttggatatc agcgatggaa gagttattca gaccatgccc 241 ggcgttaagt cacccagtga ttggcgatcc tacgcactta ctcatcatcc cggcattatc 301 attatccgga acccctttac tgagcgcggt cggcgctact ggattgcgcg atgtctacgc 361 gactatccgc ggaccccgaa catcgttaat ttaaatgaaa gactcttcga tgattcagtc 421 agatcggact ggtggaaaca gcttagtctg tgccgcgaca gggcggaatt ccagcgaatg 481 aaatcagcga tgcgctggac gacattcgga tatcaccaca actgggacac gaagcactac 541 gaggagcgga tgcagtcaca gtttccagag gacttgggca gtctgtgccg gttgttcgcg 601 tccaccttgg gctactgtga ctttaagccg gaagccgcta tcgtgaacta ctatccagtg 661 ggcagtactt tgtcgggcca cacggatcac tctgagccca atcaaacggc cccgctattc 721 tcgtttagct ttggtcagac cgcaattttt ctgatcggtg gaaggacttt ggaggaaaaa 781 ccaaccgcag tctaccttca gtgtggggac gttatgataa tgtccggaga gtcacggtta 841 tgctatcacg cagttccccg aattatgaag acccggagac ctgggaattc tccgctgaca 901 aatgaagatg ccgatgatgc tgatcatgac acccatcttg tggatatggg tttgtttcaa 961 aatgtagggg atgccagttt ttgggaacct ttttcgaatt atattgacga ttcgcgtatt 1021 aatattaatg tacgacaagt gttgaacata ggagatttaa aattgggccc ttaattgtta 1081 tttggtttgt aaaataggag tttgaaattt gaaaaattgt aaaaataaat