Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii alpha-ketoglutarate-dependent


LOCUS       XM_017140563            1130 bp    mRNA    linear   INV 09-DEC-2024
            dioxygenase AlkB (AlkB), transcript variant X1, mRNA.
ACCESSION   XM_017140563
VERSION     XM_017140563.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140563.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1130
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1130
                     /gene="AlkB"
                     /note="alpha-ketoglutarate-dependent dioxygenase AlkB;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108056682"
     CDS             91..1074
                     /gene="AlkB"
                     /codon_start=1
                     /product="nucleic acid dioxygenase ALKBH1 isoform X1"
                     /protein_id="XP_016996052.2"
                     /db_xref="GeneID:108056682"
                     /translation="MFKLAFKQYKAKSGSPDLTGVINVDDHDLRNDNIVQRLDISDGR
                     VIQTMPGVKSPSDWRSYALTHHPGIIIIRNPFTERGRRYWIARCLRDYPRTPNIVNLN
                     ERLFDDSVRSDWWKQLSLCRDRAEFQRMKSAMRWTTFGYHHNWDTKHYEERMQSQFPE
                     DLGSLCRLFASTLGYCDFKPEAAIVNYYPVGSTLSGHTDHSEPNQTAPLFSFSFGQTA
                     IFLIGGRTLEEKPTAVYLQCGDVMIMSGESRLCYHAVPRIMKTRRPGNSPLTNEDADD
                     ADHDTHLVDMGLFQNVGDASFWEPFSNYIDDSRININVRQVLNIGDLKLGP"
     misc_feature    292..903
                     /gene="AlkB"
                     /note="2OG-Fe(II) oxygenase superfamily; Region:
                     2OG-FeII_Oxy_2; pfam13532"
                     /db_xref="CDD:433285"
ORIGIN      
        1 tgaatagcat ttcagatctc ccctaacgca gtcacactac ctgtagtttg ttaaatttat
       61 tgtttaaatt gtatatatta tttatgaaat atgtttaagt tagcttttaa gcagtacaag
      121 gcgaaaagtg gcagtcccga tctaacgggc gtgatcaatg tggatgatca cgatctgcga
      181 aacgataata tcgttcaacg gttggatatc agcgatggaa gagttattca gaccatgccc
      241 ggcgttaagt cacccagtga ttggcgatcc tacgcactta ctcatcatcc cggcattatc
      301 attatccgga acccctttac tgagcgcggt cggcgctact ggattgcgcg atgtctacgc
      361 gactatccgc ggaccccgaa catcgttaat ttaaatgaaa gactcttcga tgattcagtc
      421 agatcggact ggtggaaaca gcttagtctg tgccgcgaca gggcggaatt ccagcgaatg
      481 aaatcagcga tgcgctggac gacattcgga tatcaccaca actgggacac gaagcactac
      541 gaggagcgga tgcagtcaca gtttccagag gacttgggca gtctgtgccg gttgttcgcg
      601 tccaccttgg gctactgtga ctttaagccg gaagccgcta tcgtgaacta ctatccagtg
      661 ggcagtactt tgtcgggcca cacggatcac tctgagccca atcaaacggc cccgctattc
      721 tcgtttagct ttggtcagac cgcaattttt ctgatcggtg gaaggacttt ggaggaaaaa
      781 ccaaccgcag tctaccttca gtgtggggac gttatgataa tgtccggaga gtcacggtta
      841 tgctatcacg cagttccccg aattatgaag acccggagac ctgggaattc tccgctgaca
      901 aatgaagatg ccgatgatgc tgatcatgac acccatcttg tggatatggg tttgtttcaa
      961 aatgtagggg atgccagttt ttgggaacct ttttcgaatt atattgacga ttcgcgtatt
     1021 aatattaatg tacgacaagt gttgaacata ggagatttaa aattgggccc ttaattgtta
     1081 tttggtttgt aaaataggag tttgaaattt gaaaaattgt aaaaataaat