Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140561 1104 bp mRNA linear INV 09-DEC-2024 protein 1 (Arfrp1), mRNA. ACCESSION XM_017140561 VERSION XM_017140561.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140561.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1104 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1104 /gene="Arfrp1" /note="ADP-ribosylation factor related protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056681" CDS 74..676 /gene="Arfrp1" /codon_start=1 /product="ADP-ribosylation factor-related protein 1" /protein_id="XP_016996050.1" /db_xref="GeneID:108056681" /translation="MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRN YKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDS NDRERMDESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGR RDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVRPPREND" misc_feature 128..631 /gene="Arfrp1" /note="Arf-related protein 1 (Arfrp1); Region: Arfrp1; cd04160" /db_xref="CDD:206725" misc_feature 143..166 /gene="Arfrp1" /note="G1 box; other site" /db_xref="CDD:206725" misc_feature order(149..169,236..241,305..307,473..478,482..484, 578..586) /gene="Arfrp1" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206725" misc_feature order(149..154,164..166,176..178,236..259,323..325, 338..340) /gene="Arfrp1" /note="putative GAP interaction site [polypeptide binding]; other site" /db_xref="CDD:206725" misc_feature order(179..190,218..250) /gene="Arfrp1" /note="Switch I region; other site" /db_xref="CDD:206725" misc_feature order(239..253,266..268,296..298,308..310,326..328, 332..340) /gene="Arfrp1" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206725" misc_feature 239..241 /gene="Arfrp1" /note="G2 box; other site" /db_xref="CDD:206725" misc_feature order(242..265,293..295,326..328,335..340) /gene="Arfrp1" /note="putative effector interaction site [active]" /db_xref="CDD:206725" misc_feature order(251..271,278..295) /gene="Arfrp1" /note="interswitch region [active]" /db_xref="CDD:206725" misc_feature 296..349 /gene="Arfrp1" /note="Switch II region; other site" /db_xref="CDD:206725" misc_feature 296..307 /gene="Arfrp1" /note="G3 box; other site" /db_xref="CDD:206725" misc_feature 473..484 /gene="Arfrp1" /note="G4 box; other site" /db_xref="CDD:206725" misc_feature 578..586 /gene="Arfrp1" /note="G5 box; other site" /db_xref="CDD:206725" polyA_site 1104 /gene="Arfrp1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caaaagtgcc atcactagcg tgcagtcaac aaaattaaat ttgtttttat tatttggcca 61 aatccacaat acgatgtaca cgttgatgca cggcttctac aagtacatga ctcagaagga 121 cgactactgc gtggtgatcc tgggcctgga caatgctggc aaaacgacct acctggaggc 181 cgccaaaacg acgttcacgc ggaactacaa gggcctgaat cccagcaaga tcacgacgac 241 agtgggcctt aatatcggca ccatcgacgt gcagggcgtg cggctaaatt tctgggatct 301 cggtggccag caggagctgc agtcgctgtg ggacaagtac taccaggagt cgcatggcgt 361 catctatgtg atcgactcca acgaccggga gcgcatggac gagtccaagg cgatctttga 421 taagatgatc aagaacgagc tgctgtccgg cgtgcctttg ctcatcctgg ccaacaagca 481 ggatctgccc gatgtgatgg gcgtgcggga gatcaagccc gtgttccagc aggcgggcgc 541 cttgattggc cgccgagatt gcctcaccat tcccgtgtcc gcccttcatg gcgagggcgt 601 cgacgagggc atcaagtggc tggtggaggc tattaaacgg catgcggtgg tccggccgcc 661 gcgggaaaac gactagaggg atcagacatg ggcccatcac agacccatct ccactggctt 721 taattagact cgtatttttg taactttagg gcttaggact acgcttattt gtaattagcc 781 gggtaggaga ttgtgagata ccaattgtac attgttgtaa atgcggatgg tatagccgct 841 ttatctaaca acagccttgc aacggcctta actagatttg ttttccatag actcgtgtct 901 ttctgttggg cttaaagtag ctttgaaatg gggaaaccca ttttgataga aagatctcag 961 catatgacag cgaattacac ataaaattgt tacaattaaa gtaaaaataa ctaggattcc 1021 cttcctcaat gaaacatgga attttgtaaa tagttcgtac tttgtatatt taatcccttc 1081 aagaaataaa atacttatac ttaa