Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ADP-ribosylation factor related


LOCUS       XM_017140561            1104 bp    mRNA    linear   INV 09-DEC-2024
            protein 1 (Arfrp1), mRNA.
ACCESSION   XM_017140561
VERSION     XM_017140561.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140561.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1104
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1104
                     /gene="Arfrp1"
                     /note="ADP-ribosylation factor related protein 1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056681"
     CDS             74..676
                     /gene="Arfrp1"
                     /codon_start=1
                     /product="ADP-ribosylation factor-related protein 1"
                     /protein_id="XP_016996050.1"
                     /db_xref="GeneID:108056681"
                     /translation="MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRN
                     YKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDS
                     NDRERMDESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGR
                     RDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVRPPREND"
     misc_feature    128..631
                     /gene="Arfrp1"
                     /note="Arf-related protein 1 (Arfrp1); Region: Arfrp1;
                     cd04160"
                     /db_xref="CDD:206725"
     misc_feature    143..166
                     /gene="Arfrp1"
                     /note="G1 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(149..169,236..241,305..307,473..478,482..484,
                     578..586)
                     /gene="Arfrp1"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206725"
     misc_feature    order(149..154,164..166,176..178,236..259,323..325,
                     338..340)
                     /gene="Arfrp1"
                     /note="putative GAP interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(179..190,218..250)
                     /gene="Arfrp1"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(239..253,266..268,296..298,308..310,326..328,
                     332..340)
                     /gene="Arfrp1"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206725"
     misc_feature    239..241
                     /gene="Arfrp1"
                     /note="G2 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    order(242..265,293..295,326..328,335..340)
                     /gene="Arfrp1"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206725"
     misc_feature    order(251..271,278..295)
                     /gene="Arfrp1"
                     /note="interswitch region [active]"
                     /db_xref="CDD:206725"
     misc_feature    296..349
                     /gene="Arfrp1"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206725"
     misc_feature    296..307
                     /gene="Arfrp1"
                     /note="G3 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    473..484
                     /gene="Arfrp1"
                     /note="G4 box; other site"
                     /db_xref="CDD:206725"
     misc_feature    578..586
                     /gene="Arfrp1"
                     /note="G5 box; other site"
                     /db_xref="CDD:206725"
     polyA_site      1104
                     /gene="Arfrp1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caaaagtgcc atcactagcg tgcagtcaac aaaattaaat ttgtttttat tatttggcca
       61 aatccacaat acgatgtaca cgttgatgca cggcttctac aagtacatga ctcagaagga
      121 cgactactgc gtggtgatcc tgggcctgga caatgctggc aaaacgacct acctggaggc
      181 cgccaaaacg acgttcacgc ggaactacaa gggcctgaat cccagcaaga tcacgacgac
      241 agtgggcctt aatatcggca ccatcgacgt gcagggcgtg cggctaaatt tctgggatct
      301 cggtggccag caggagctgc agtcgctgtg ggacaagtac taccaggagt cgcatggcgt
      361 catctatgtg atcgactcca acgaccggga gcgcatggac gagtccaagg cgatctttga
      421 taagatgatc aagaacgagc tgctgtccgg cgtgcctttg ctcatcctgg ccaacaagca
      481 ggatctgccc gatgtgatgg gcgtgcggga gatcaagccc gtgttccagc aggcgggcgc
      541 cttgattggc cgccgagatt gcctcaccat tcccgtgtcc gcccttcatg gcgagggcgt
      601 cgacgagggc atcaagtggc tggtggaggc tattaaacgg catgcggtgg tccggccgcc
      661 gcgggaaaac gactagaggg atcagacatg ggcccatcac agacccatct ccactggctt
      721 taattagact cgtatttttg taactttagg gcttaggact acgcttattt gtaattagcc
      781 gggtaggaga ttgtgagata ccaattgtac attgttgtaa atgcggatgg tatagccgct
      841 ttatctaaca acagccttgc aacggcctta actagatttg ttttccatag actcgtgtct
      901 ttctgttggg cttaaagtag ctttgaaatg gggaaaccca ttttgataga aagatctcag
      961 catatgacag cgaattacac ataaaattgt tacaattaaa gtaaaaataa ctaggattcc
     1021 cttcctcaat gaaacatgga attttgtaaa tagttcgtac tttgtatatt taatcccttc
     1081 aagaaataaa atacttatac ttaa