PREDICTED: Drosophila takahashii fibroleukin-like (LOC108056674),

LOCUS       XM_017140555            1011 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017140555
VERSION     XM_017140555.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140555.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 41% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1011
                     /gene="LOC108056674"
                     /note="fibroleukin-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108056674"
     CDS             1..1011
                     /gene="LOC108056674"
                     /codon_start=1
                     /product="fibroleukin-like"
                     /protein_id="XP_016996044.3"
                     /db_xref="GeneID:108056674"
                     /translation="MISRLAFLLSVFLINELSIIGANPDNFEIKNVVVMNINHQPTAN
                     QDNQIRDQNEELKNQIKNITQLLKNTDEKVSFMSTSIGNLQRNLEIARNEIQNKETQI
                     NDITKKLSNQISELKDDLFKCQPRSSCPVEGPNGIYNITVGDIHAFEAPCNSTGWLTI
                     QKRFDGSENFDRTWKDYKDGFGNIEGEFFIGLERLHIMTQAQPHELRIELGMVNGSTS
                     YAHYDDFKIGSEEELYELESLGIYNGTAGDSLKDHNEKKFTTHDRDNDESKRNCATKE
                     WGGWWYTSCARSKLNAKYHKEGYSEHNDGITWGSWHNSNYTYSLTFVEMMIRPKTLKT
                     EV"
     misc_feature    127..>360
                     /gene="LOC108056674"
                     /note="Septal ring factor EnvC, activator of murein
                     hydrolases AmiA and AmiB [Cell cycle control, cell
                     division, chromosome partitioning]; Region: EnvC; COG4942"
                     /db_xref="CDD:443969"
     misc_feature    394..990
                     /gene="LOC108056674"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    703..705
                     /gene="LOC108056674"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(790..792,796..798,802..804)
                     /gene="LOC108056674"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(814..816,823..828,853..858)
                     /gene="LOC108056674"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
ORIGIN      
        1 atgatatcgc gcttggcgtt tctcctgtcg gttttcctta tcaacgagct atccattatc
       61 ggtgcaaatc cagataactt cgaaataaaa aatgtggtag ttatgaatat taatcaccaa
      121 ccaacggcga atcaagataa tcaaatccgt gatcaaaatg aagaactgaa aaaccaaatc
      181 aaaaacatta ctcaactact caaaaataca gatgagaaag ttagttttat gagcacaagt
      241 attggtaatt tgcagagaaa tttagaaata gctaggaatg aaatacaaaa caaagaaacc
      301 cagatcaatg atataactaa aaaacttagt aaccaaatat cggaactcaa agatgatctt
      361 ttcaagtgcc aacccagatc cagttgtccc gtcgaaggac caaatggcat ttacaatatt
      421 acagtaggag atatacatgc attcgaagct ccgtgcaatt caacgggttg gctaacaata
      481 caaaaacgtt tcgacggctc cgagaatttc gatcgaacct ggaaggatta caaagacggc
      541 ttcggcaata tagaaggaga atttttcatc ggactcgaga gattgcacat tatgactcag
      601 gcacaaccac acgaactgcg cattgaactt ggcatggtaa atggatccac tagctatgcc
      661 cattatgatg acttcaagat tggaagtgaa gaagaattgt atgaactcga atcgctgggg
      721 atatataatg gtacagccgg tgactctctc aaagatcata acgagaaaaa gttcaccaca
      781 catgacaggg ataatgatga atctaaacgg aattgcgcta ccaaggagtg gggtggttgg
      841 tggtacacgt cctgtgctcg gagcaagctt aatgcaaagt accataaaga aggttactct
      901 gaacataacg atggaattac ttggggttcc tggcataaca gcaattacac ctactcgctc
      961 acctttgtcg aaatgatgat aaggcctaaa acgttaaaaa ctgaagtttg a