Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140250 1014 bp mRNA linear INV 09-DEC-2024 L49 (mRpL49), mRNA. ACCESSION XM_017140250 VERSION XM_017140250.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140250.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1014 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1014 /gene="mRpL49" /note="mitochondrial ribosomal protein L49; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056453" CDS 151..690 /gene="mRpL49" /codon_start=1 /product="large ribosomal subunit protein mL49" /protein_id="XP_016995739.2" /db_xref="GeneID:108056453" /translation="MAASGKLMLGSGLCRKLSQFTRQLHTQPALLSSFRSSREVQPLD KYPDVEVVAQPPEWRFVERLLPAETVPQPVERPKYPSGWRPQRENGSQAGYFVARTKN HMVPVYLQTRFRGQRRITVVRRVQGDIWSLEKDLRAVVEQSRNGKLCATRINELSGQI HFHGDHVDVLRDYLKEKGF" misc_feature 433..687 /gene="mRpL49" /note="Mitochondrial large subunit ribosomal protein (Img2); Region: Img2; pfam05046" /db_xref="CDD:461535" polyA_site 1014 /gene="mRpL49" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaatgcaaca acagcaaaaa acgaacggcg gcaaaaaaca acaacaaatg ctcgaagctt 61 cgcggactat cggtgggtca gctgttctca tcggaattat cgatagcacg cgattggagc 121 ggaaaaacac ccgagattcc cacgaataac atggcagcca gtggaaaatt gatgctgggc 181 agcggcctct gccgaaagct gagccagttc accaggcagc tgcatacgca accggcgctc 241 ttgtccagtt ttcggtcatc ccgcgaggtg cagccgctgg acaagtatcc cgacgtggag 301 gtggtggccc agccgcccga gtggcgcttc gtggagcgcc tgctgccggc ggagacggtg 361 ccacagccgg tggagcgacc aaaataccca tccggctggc ggccgcagag ggaaaatgga 421 tcgcaggcgg gctactttgt ggccaggacc aagaaccaca tggtgccggt ctacctgcag 481 acccggttcc gtggccagcg acgcatcacg gtggtgcgcc gcgtccaggg agacatctgg 541 tcgctggaaa aggacctgcg ggcggtggtg gagcagtcgc ggaacgggaa gctctgcgcc 601 accaggatca acgagctgag cggacagatt cacttccacg gcgaccatgt ggacgtcctg 661 cgggactatc tcaaggagaa gggcttctag gaggtccgcc atctgccgca ataaactcgt 721 tttctgttga tttaaaagaa ttgttggatt attgattgaa attaggtatt tagatagaga 781 aaacatcaga atatctttca aaaaattgga ttttctagtc ctgtaaggga ttttagacac 841 ttttgtaggc gaacttcaaa gagaaacttt tataaattat gtttttgaga ttttctattg 901 aattaaatga actttcgatt aaaatccggg ataaacatgg agaaaacatc tgagaattgc 961 agaatatcct ccaagaactt ggatttccta ttcctgtaaa ggattttaca ctaa