Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial ribosomal protein


LOCUS       XM_017140250            1014 bp    mRNA    linear   INV 09-DEC-2024
            L49 (mRpL49), mRNA.
ACCESSION   XM_017140250
VERSION     XM_017140250.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140250.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1014
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1014
                     /gene="mRpL49"
                     /note="mitochondrial ribosomal protein L49; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056453"
     CDS             151..690
                     /gene="mRpL49"
                     /codon_start=1
                     /product="large ribosomal subunit protein mL49"
                     /protein_id="XP_016995739.2"
                     /db_xref="GeneID:108056453"
                     /translation="MAASGKLMLGSGLCRKLSQFTRQLHTQPALLSSFRSSREVQPLD
                     KYPDVEVVAQPPEWRFVERLLPAETVPQPVERPKYPSGWRPQRENGSQAGYFVARTKN
                     HMVPVYLQTRFRGQRRITVVRRVQGDIWSLEKDLRAVVEQSRNGKLCATRINELSGQI
                     HFHGDHVDVLRDYLKEKGF"
     misc_feature    433..687
                     /gene="mRpL49"
                     /note="Mitochondrial large subunit ribosomal protein
                     (Img2); Region: Img2; pfam05046"
                     /db_xref="CDD:461535"
     polyA_site      1014
                     /gene="mRpL49"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatgcaaca acagcaaaaa acgaacggcg gcaaaaaaca acaacaaatg ctcgaagctt
       61 cgcggactat cggtgggtca gctgttctca tcggaattat cgatagcacg cgattggagc
      121 ggaaaaacac ccgagattcc cacgaataac atggcagcca gtggaaaatt gatgctgggc
      181 agcggcctct gccgaaagct gagccagttc accaggcagc tgcatacgca accggcgctc
      241 ttgtccagtt ttcggtcatc ccgcgaggtg cagccgctgg acaagtatcc cgacgtggag
      301 gtggtggccc agccgcccga gtggcgcttc gtggagcgcc tgctgccggc ggagacggtg
      361 ccacagccgg tggagcgacc aaaataccca tccggctggc ggccgcagag ggaaaatgga
      421 tcgcaggcgg gctactttgt ggccaggacc aagaaccaca tggtgccggt ctacctgcag
      481 acccggttcc gtggccagcg acgcatcacg gtggtgcgcc gcgtccaggg agacatctgg
      541 tcgctggaaa aggacctgcg ggcggtggtg gagcagtcgc ggaacgggaa gctctgcgcc
      601 accaggatca acgagctgag cggacagatt cacttccacg gcgaccatgt ggacgtcctg
      661 cgggactatc tcaaggagaa gggcttctag gaggtccgcc atctgccgca ataaactcgt
      721 tttctgttga tttaaaagaa ttgttggatt attgattgaa attaggtatt tagatagaga
      781 aaacatcaga atatctttca aaaaattgga ttttctagtc ctgtaaggga ttttagacac
      841 ttttgtaggc gaacttcaaa gagaaacttt tataaattat gtttttgaga ttttctattg
      901 aattaaatga actttcgatt aaaatccggg ataaacatgg agaaaacatc tgagaattgc
      961 agaatatcct ccaagaactt ggatttccta ttcctgtaaa ggattttaca ctaa