Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017140236             671 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056444), mRNA.
ACCESSION   XM_017140236
VERSION     XM_017140236.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140236.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..671
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..671
                     /gene="LOC108056444"
                     /note="uncharacterized LOC108056444; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056444"
     CDS             74..496
                     /gene="LOC108056444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995725.2"
                     /db_xref="GeneID:108056444"
                     /translation="MPVLKLATFYTQFFPSERVRCRELKRRRQLMRLLEERKLEIENQ
                     AQPKCPKEPANFELQSKHVIGSFQLRFERDPLSERLEITATLPSPRLPPETEPEPQDE
                     LLYELYVCSSQGRLLARIPFLESDYRRAAHRAINCMSI"
ORIGIN      
        1 gcttgctagc cgccgtccac atcagattct ctgtactttt gaaatagaaa taaaaattta
       61 aaaaaaaaca gaaatgcccg ttttaaagct agccactttc tatacccaat tctttccctc
      121 ggagcgagtg cgttgcaggg agctgaagcg caggaggcag ctgatgaggt tactggagga
      181 gcgaaagttg gaaatagaga accaagctca gccgaagtgc cccaaggaac ccgcgaactt
      241 tgaactccag tcgaagcatg tgattggcag ctttcagctg aggttcgagc gagatccgct
      301 gagcgagagg ctggagatca cggccacgct gcccagcccg cgacttccgc cggaaacgga
      361 accggagccg caggacgagc tgctctacga gctgtacgtg tgcagcagcc agggtcgcct
      421 gctggccagg attcccttcc tggagagcga ctaccgacgt gccgcccaca gggccatcaa
      481 ttgcatgtcc atctagtgcg gaaaaagaac cctccacatt catcctcgct ttgagtatcg
      541 attacctgtt acagcgccat cctcagctcc acctccttaa ttggaagccg gatcgtaaat
      601 taaccgagag ctgcaaacct gtaaactgat ctttgggcct caataaattt aatgtaactg
      661 tatgcccttt a