Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140236 671 bp mRNA linear INV 09-DEC-2024 (LOC108056444), mRNA. ACCESSION XM_017140236 VERSION XM_017140236.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140236.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..671 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..671 /gene="LOC108056444" /note="uncharacterized LOC108056444; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056444" CDS 74..496 /gene="LOC108056444" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016995725.2" /db_xref="GeneID:108056444" /translation="MPVLKLATFYTQFFPSERVRCRELKRRRQLMRLLEERKLEIENQ AQPKCPKEPANFELQSKHVIGSFQLRFERDPLSERLEITATLPSPRLPPETEPEPQDE LLYELYVCSSQGRLLARIPFLESDYRRAAHRAINCMSI" ORIGIN 1 gcttgctagc cgccgtccac atcagattct ctgtactttt gaaatagaaa taaaaattta 61 aaaaaaaaca gaaatgcccg ttttaaagct agccactttc tatacccaat tctttccctc 121 ggagcgagtg cgttgcaggg agctgaagcg caggaggcag ctgatgaggt tactggagga 181 gcgaaagttg gaaatagaga accaagctca gccgaagtgc cccaaggaac ccgcgaactt 241 tgaactccag tcgaagcatg tgattggcag ctttcagctg aggttcgagc gagatccgct 301 gagcgagagg ctggagatca cggccacgct gcccagcccg cgacttccgc cggaaacgga 361 accggagccg caggacgagc tgctctacga gctgtacgtg tgcagcagcc agggtcgcct 421 gctggccagg attcccttcc tggagagcga ctaccgacgt gccgcccaca gggccatcaa 481 ttgcatgtcc atctagtgcg gaaaaagaac cctccacatt catcctcgct ttgagtatcg 541 attacctgtt acagcgccat cctcagctcc acctccttaa ttggaagccg gatcgtaaat 601 taaccgagag ctgcaaacct gtaaactgat ctttgggcct caataaattt aatgtaactg 661 tatgcccttt a