Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii V-type proton ATPase subunit F


LOCUS       XM_017140235             693 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056443), mRNA.
ACCESSION   XM_017140235
VERSION     XM_017140235.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140235.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..693
                     /gene="LOC108056443"
                     /note="V-type proton ATPase subunit F; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108056443"
     CDS             47..520
                     /gene="LOC108056443"
                     /codon_start=1
                     /product="V-type proton ATPase subunit F"
                     /protein_id="XP_016995724.2"
                     /db_xref="GeneID:108056443"
                     /translation="MASRKKAMTPKHESDRMSEAGPKSGSESDLSDSEMQIYIKAVED
                     PNVLRIAVMADPEVTLGFLLAGIGYQRDRFRNYMMVESETPQEDLESFFLAVYRRANI
                     GIIILDYDTAKRLRNVMQRCNQLLPVLVTVPNKSSLTTYLDKKERNRRLRQRDAY"
     misc_feature    194..457
                     /gene="LOC108056443"
                     /note="ATP synthase (F/14-kDa) subunit; Region:
                     ATP-synt_F; pfam01990"
                     /db_xref="CDD:460409"
ORIGIN      
        1 ccattttttt ttcgagcaga gacaggggat caggaatcag ttagaaatgg catccaggaa
       61 gaaggctatg acgccaaagc acgaatcgga cagaatgtcc gaggcggggc caaaatcggg
      121 tagcgaaagc gatttgagcg acagcgagat gcagatctat atcaaagctg tggaagatcc
      181 gaatgtcctg cgaattgcgg tcatggccga tcccgaggta acactgggct ttctgctggc
      241 tggcattggc taccaaaggg acaggtttcg caactatatg atggtggaaa gcgaaacgcc
      301 gcaggaggat ctggagagct tctttctcgc cgtttacagg cgcgcgaaca tcggcattat
      361 tattctcgat tacgatacgg ccaagagact tcgcaacgtg atgcagcgat gcaatcagct
      421 gcttcctgtt ttggtcacag tgcccaacaa gtcctcgctg accacgtatt tggacaaaaa
      481 ggagcgcaat cgccgacttc gccaaaggga cgcctactag gatctgaagt tagagcgtac
      541 ttttctcctg tccccttgct ctgccacaaa ataaaattaa gaatatctgc ttcaaatatt
      601 taaaatctag aaattatagt ttattttgct tctattttat gttaacaaat tctagtcagt
      661 aatctactag aatctaaaga agaaactaaa gat