Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140235 693 bp mRNA linear INV 09-DEC-2024 (LOC108056443), mRNA. ACCESSION XM_017140235 VERSION XM_017140235.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140235.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..693 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..693 /gene="LOC108056443" /note="V-type proton ATPase subunit F; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108056443" CDS 47..520 /gene="LOC108056443" /codon_start=1 /product="V-type proton ATPase subunit F" /protein_id="XP_016995724.2" /db_xref="GeneID:108056443" /translation="MASRKKAMTPKHESDRMSEAGPKSGSESDLSDSEMQIYIKAVED PNVLRIAVMADPEVTLGFLLAGIGYQRDRFRNYMMVESETPQEDLESFFLAVYRRANI GIIILDYDTAKRLRNVMQRCNQLLPVLVTVPNKSSLTTYLDKKERNRRLRQRDAY" misc_feature 194..457 /gene="LOC108056443" /note="ATP synthase (F/14-kDa) subunit; Region: ATP-synt_F; pfam01990" /db_xref="CDD:460409" ORIGIN 1 ccattttttt ttcgagcaga gacaggggat caggaatcag ttagaaatgg catccaggaa 61 gaaggctatg acgccaaagc acgaatcgga cagaatgtcc gaggcggggc caaaatcggg 121 tagcgaaagc gatttgagcg acagcgagat gcagatctat atcaaagctg tggaagatcc 181 gaatgtcctg cgaattgcgg tcatggccga tcccgaggta acactgggct ttctgctggc 241 tggcattggc taccaaaggg acaggtttcg caactatatg atggtggaaa gcgaaacgcc 301 gcaggaggat ctggagagct tctttctcgc cgtttacagg cgcgcgaaca tcggcattat 361 tattctcgat tacgatacgg ccaagagact tcgcaacgtg atgcagcgat gcaatcagct 421 gcttcctgtt ttggtcacag tgcccaacaa gtcctcgctg accacgtatt tggacaaaaa 481 ggagcgcaat cgccgacttc gccaaaggga cgcctactag gatctgaagt tagagcgtac 541 ttttctcctg tccccttgct ctgccacaaa ataaaattaa gaatatctgc ttcaaatatt 601 taaaatctag aaattatagt ttattttgct tctattttat gttaacaaat tctagtcagt 661 aatctactag aatctaaaga agaaactaaa gat