Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140230 523 bp mRNA linear INV 09-DEC-2024 (LOC108056440), mRNA. ACCESSION XM_017140230 VERSION XM_017140230.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140230.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..523 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..523 /gene="LOC108056440" /note="uncharacterized LOC108056440; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056440" CDS 93..437 /gene="LOC108056440" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016995719.2" /db_xref="GeneID:108056440" /translation="MFRQHKSINVYVPPMSSFPEPSLLGGYGLEDRMEVPKSTEVPED VLAGREEPHFLYVIDSRGRLLEHIRYYGDDYRMALREAFASKNVPLSDADFRMDPSRE SQNENSCPWLPK" ORIGIN 1 tttttgttga atacttacaa tcgaccaaaa ctttcttacc gagctgtgtt tcccttttga 61 tcagttttaa ccaaattccc gtaaaactaa ggatgttccg ccagcataaa agcatcaacg 121 tgtatgtgcc gccgatgagt agttttccgg aacccagttt gctgggcggc tatggactgg 181 aggatcgcat ggaggtgccc aagtcgacgg aggtccctga ggatgtcctc gcgggtcggg 241 aggagccgca cttcctctac gtaatcgaca gccggggacg tcttttggag cacattcgat 301 actacgggga cgattaccgg atggccctgc gggaggcctt cgcctcgaag aatgttccgc 361 tgagtgatgc agattttaga atggacccaa gtcgggaatc gcagaacgaa aattcctgcc 421 cgtggctccc caaataagta aattaattga tcaaaattgc aagcaaaaat tctataaaac 481 tcctggcttg tttttggtca tagggaaact catgaataaa tga