Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017140230             523 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056440), mRNA.
ACCESSION   XM_017140230
VERSION     XM_017140230.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140230.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..523
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..523
                     /gene="LOC108056440"
                     /note="uncharacterized LOC108056440; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056440"
     CDS             93..437
                     /gene="LOC108056440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995719.2"
                     /db_xref="GeneID:108056440"
                     /translation="MFRQHKSINVYVPPMSSFPEPSLLGGYGLEDRMEVPKSTEVPED
                     VLAGREEPHFLYVIDSRGRLLEHIRYYGDDYRMALREAFASKNVPLSDADFRMDPSRE
                     SQNENSCPWLPK"
ORIGIN      
        1 tttttgttga atacttacaa tcgaccaaaa ctttcttacc gagctgtgtt tcccttttga
       61 tcagttttaa ccaaattccc gtaaaactaa ggatgttccg ccagcataaa agcatcaacg
      121 tgtatgtgcc gccgatgagt agttttccgg aacccagttt gctgggcggc tatggactgg
      181 aggatcgcat ggaggtgccc aagtcgacgg aggtccctga ggatgtcctc gcgggtcggg
      241 aggagccgca cttcctctac gtaatcgaca gccggggacg tcttttggag cacattcgat
      301 actacgggga cgattaccgg atggccctgc gggaggcctt cgcctcgaag aatgttccgc
      361 tgagtgatgc agattttaga atggacccaa gtcgggaatc gcagaacgaa aattcctgcc
      421 cgtggctccc caaataagta aattaattga tcaaaattgc aagcaaaaat tctataaaac
      481 tcctggcttg tttttggtca tagggaaact catgaataaa tga