Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140207 1201 bp mRNA linear INV 09-DEC-2024 (Rtca), mRNA. ACCESSION XM_017140207 VERSION XM_017140207.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140207.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1201 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1201 /gene="Rtca" /note="RNA 3'-terminal phosphate cyclase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056421" CDS 113..1201 /gene="Rtca" /codon_start=1 /product="RNA 3'-terminal phosphate cyclase" /protein_id="XP_016995696.2" /db_xref="GeneID:108056421" /translation="MDDKGFVEIDGSYLEGGGQALRNALSLSCILGKPVRVTKIRANR PKPGLSHQHLHGVNLLRDICNADVAGNTLLSTELEFTPRTIRGSTYRVETHTAASITL IYQMALPVLLFAGRPSRLFVAGGTNVAFAPPVEYMQQVLLPHLKPLGASFDLKVQQYG FYPRGQGSCQLDVQPVEKLKAGQFLDFGRLQLVSGVAFTAGRLPKSLAIDMQQTAQRE IHRLLPEMHEISVEAVKHAPEKARDNGAGILMTAHTTGGCILGAASLGQKRVDGQALG SEASLRLAEYVRKEICVDEHMQDQLIIYMALAAGRSRMRTGPLSSHTRTAIHVAEQLA GVRFEVTLEAAGQTLVECEGAGQLNGML" misc_feature 131..1129 /gene="Rtca" /note="RNA 3'-phosphate cyclase; Region: RNA_3prim_cycl; TIGR03399" /db_xref="CDD:274563" ORIGIN 1 gccggcaacg ggcacactga gaagtgccgg tccaattgga atccaatggg atggaggcaa 61 atttcctgac aacttgaaag aaaagcagcc ggaaaagcga caagtcgtga aaatggacga 121 caagggtttc gtggagatcg acggctccta cctggagggc ggcgggcagg cgctgcgcaa 181 cgccctgagc ctcagctgca tcctgggcaa gccggtgcgc gtgaccaaga tccgggcgaa 241 tcgccccaag ccgggactct cccaccagca tttgcacggc gtgaacctgc tgcgggacat 301 ctgcaacgcc gacgttgcag gcaacacgct gctctccacc gaactcgaat tcacgccgcg 361 caccatccgg ggcagcacgt accgcgtgga gacgcacacg gcggccagca tcacgctgat 421 ctaccaaatg gccctgcccg tcctgctctt cgccggccgc ccctcccgcc tgttcgtcgc 481 cggcggcacg aacgtggcct tcgccccgcc ggtggagtac atgcagcagg tgctgctgcc 541 gcatctgaag cccctgggcg cctccttcga cctcaaggtg cagcagtacg gcttctatcc 601 acgcggccag ggcagctgcc agctggacgt gcagccggtg gaaaagctga aggctgggca 661 gttcctggac tttggccgcc tgcagctggt cagcggagtg gccttcaccg ccggccgttt 721 gcccaagagc ctggcgatcg acatgcagca gacggcgcag cgcgagatcc atcgcctctt 781 gccggagatg cacgagatca gcgtcgaggc ggtgaagcat gcgcctgaga aggcgcgcga 841 caacggagcc ggcattctga tgacggccca cacaaccggc ggctgcatcc tgggcgccgc 901 ttcgctgggc cagaagcgag tcgacgggca ggcgctcggc tcggaggcct ccctccggct 961 ggccgagtac gtgcgcaagg agatctgcgt ggacgagcac atgcaggacc agctgatcat 1021 ctacatggcc ctggcggcgg gccgctcgag gatgcgcacc ggaccgctga gcagccacac 1081 gcgcaccgcc atccatgtgg ccgagcagct ggccggcgtc cggttcgagg tgaccctgga 1141 ggccgccggc cagacgctgg tcgaatgcga gggagcggga caactgaacg ggatgcttta 1201 a