Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RNA 3'-terminal phosphate cyclase


LOCUS       XM_017140207            1201 bp    mRNA    linear   INV 09-DEC-2024
            (Rtca), mRNA.
ACCESSION   XM_017140207
VERSION     XM_017140207.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140207.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1201
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1201
                     /gene="Rtca"
                     /note="RNA 3'-terminal phosphate cyclase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056421"
     CDS             113..1201
                     /gene="Rtca"
                     /codon_start=1
                     /product="RNA 3'-terminal phosphate cyclase"
                     /protein_id="XP_016995696.2"
                     /db_xref="GeneID:108056421"
                     /translation="MDDKGFVEIDGSYLEGGGQALRNALSLSCILGKPVRVTKIRANR
                     PKPGLSHQHLHGVNLLRDICNADVAGNTLLSTELEFTPRTIRGSTYRVETHTAASITL
                     IYQMALPVLLFAGRPSRLFVAGGTNVAFAPPVEYMQQVLLPHLKPLGASFDLKVQQYG
                     FYPRGQGSCQLDVQPVEKLKAGQFLDFGRLQLVSGVAFTAGRLPKSLAIDMQQTAQRE
                     IHRLLPEMHEISVEAVKHAPEKARDNGAGILMTAHTTGGCILGAASLGQKRVDGQALG
                     SEASLRLAEYVRKEICVDEHMQDQLIIYMALAAGRSRMRTGPLSSHTRTAIHVAEQLA
                     GVRFEVTLEAAGQTLVECEGAGQLNGML"
     misc_feature    131..1129
                     /gene="Rtca"
                     /note="RNA 3'-phosphate cyclase; Region: RNA_3prim_cycl;
                     TIGR03399"
                     /db_xref="CDD:274563"
ORIGIN      
        1 gccggcaacg ggcacactga gaagtgccgg tccaattgga atccaatggg atggaggcaa
       61 atttcctgac aacttgaaag aaaagcagcc ggaaaagcga caagtcgtga aaatggacga
      121 caagggtttc gtggagatcg acggctccta cctggagggc ggcgggcagg cgctgcgcaa
      181 cgccctgagc ctcagctgca tcctgggcaa gccggtgcgc gtgaccaaga tccgggcgaa
      241 tcgccccaag ccgggactct cccaccagca tttgcacggc gtgaacctgc tgcgggacat
      301 ctgcaacgcc gacgttgcag gcaacacgct gctctccacc gaactcgaat tcacgccgcg
      361 caccatccgg ggcagcacgt accgcgtgga gacgcacacg gcggccagca tcacgctgat
      421 ctaccaaatg gccctgcccg tcctgctctt cgccggccgc ccctcccgcc tgttcgtcgc
      481 cggcggcacg aacgtggcct tcgccccgcc ggtggagtac atgcagcagg tgctgctgcc
      541 gcatctgaag cccctgggcg cctccttcga cctcaaggtg cagcagtacg gcttctatcc
      601 acgcggccag ggcagctgcc agctggacgt gcagccggtg gaaaagctga aggctgggca
      661 gttcctggac tttggccgcc tgcagctggt cagcggagtg gccttcaccg ccggccgttt
      721 gcccaagagc ctggcgatcg acatgcagca gacggcgcag cgcgagatcc atcgcctctt
      781 gccggagatg cacgagatca gcgtcgaggc ggtgaagcat gcgcctgaga aggcgcgcga
      841 caacggagcc ggcattctga tgacggccca cacaaccggc ggctgcatcc tgggcgccgc
      901 ttcgctgggc cagaagcgag tcgacgggca ggcgctcggc tcggaggcct ccctccggct
      961 ggccgagtac gtgcgcaagg agatctgcgt ggacgagcac atgcaggacc agctgatcat
     1021 ctacatggcc ctggcggcgg gccgctcgag gatgcgcacc ggaccgctga gcagccacac
     1081 gcgcaccgcc atccatgtgg ccgagcagct ggccggcgtc cggttcgagg tgaccctgga
     1141 ggccgccggc cagacgctgg tcgaatgcga gggagcggga caactgaacg ggatgcttta
     1201 a