Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cytochrome P450 4d1 (Cyp4d1),


LOCUS       XM_017140202            1749 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_017140202
VERSION     XM_017140202.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140202.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1749
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1749
                     /gene="Cyp4d1"
                     /note="Cytochrome P450 4d1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 22
                     Proteins"
                     /db_xref="GeneID:108056419"
     CDS             175..1698
                     /gene="Cyp4d1"
                     /codon_start=1
                     /product="cytochrome P450 4d1 isoform X2"
                     /protein_id="XP_016995691.2"
                     /db_xref="GeneID:108056419"
                     /translation="MWLLLALVLLLAILALEMLRFVRNMRTVPAPLPLPLLGNAHLFW
                     GLSPAEAILKIGELAERHGDAFGLFLGPSYSVMLFNPRDVEKVLNSTQLLNKSQEYSF
                     LNRWLNEGLLVSSGRKWHRRRKIITPAFHFRILEPYVEIFDRQSLRLVEELRLKRSRG
                     QEKINLGEAIHLCTLDAICETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYR
                     FDLTYMLTPLARAEKKALDVLHQFTEKIIVQRREEIIRGGNGGDQGSTGSTEDADVGA
                     KRKMAFLDILLQSTIDERPLSNLDIREEVDTFMFEGHDTTSSALMFLFYNIATHPEAQ
                     RRCFEEIRSVMGEDRSTPVTYELLNRLHYVDLCVKETLRMYPSVPLLGRKVLEDCEIN
                     GKLIPAGTNIGISPLYLGRREELFSEPNSFKPERFDVVTTAEKLNPYAYIPFSAGPRN
                     CIGQKFAMLEIKAIAANVLRHYEVDFVGDTSQPPVLIAELILRTKDPLMFKVRERVY"
     misc_feature    361..1671
                     /gene="Cyp4d1"
                     /note="cytochrome P450 family 4; Region: CYP4; cd20628"
                     /db_xref="CDD:410721"
     misc_feature    order(454..456,505..510,529..531,541..543,562..564,
                     1096..1098,1105..1110,1117..1119,1303..1305,1315..1317,
                     1501..1509,1519..1533,1540..1545,1555..1557)
                     /gene="Cyp4d1"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:410721"
     misc_feature    order(508..510,1102..1107,1117..1119,1312..1314,
                     1318..1320)
                     /gene="Cyp4d1"
                     /note="chemical substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:410721"
ORIGIN      
        1 tggaaaatac ataattcgga tcaccaatga tttcccaatt gccatctcta gttgagctgc
       61 tgataagcag ccggcatctt gggttatcaa cgtgttgagt tagtcgcgag ctgggcatgt
      121 gaagcagacg gcagcatcgc ctgcagtgaa ctggtcatcc ccattccccc gaaaatgtgg
      181 ctcctgctgg cactcgtcct gctcctggcg atcctggccc tggagatgct gcgcttcgtg
      241 cggaacatgc ggactgttcc ggctcctctg ccgctgcccc tgctgggcaa tgcccatctc
      301 ttctggggcc tcagccccgc ggaggcgatc ctgaagattg gcgaactggc ggagcggcac
      361 ggcgacgcct tcggcctctt cctggggccc tcctacagcg tgatgctctt caatccgcgc
      421 gacgtggaga aggtgctgaa cagcacccag ctgctgaaca agtcgcagga gtactccttc
      481 ctcaaccgct ggctgaacga gggactgctg gtgagcagtg gacgcaagtg gcaccgccgc
      541 cgcaagatca tcaccccggc cttccacttc cgcatcctgg agccctacgt ggagatcttc
      601 gacaggcaga gtcttcgtct cgtcgaggag ctgcggctga agaggagcag agggcaggag
      661 aagatcaacc tgggcgaggc cattcacctc tgcaccttgg acgccatttg cgaaaccgcc
      721 atgggtgtgt ccatcaatgc ccaatcgaat gccgattccg agtatgttca ggcggtaaaa
      781 accatatcga tggtgctgca caagcgcatg ttcaacatcc tctaccgctt cgacctcacc
      841 tacatgctga cccctttggc gcgggccgag aagaaggcgc tggatgtgct gcaccagttc
      901 accgagaaga tcattgtgca gcgaagggag gagattatcc gtggaggaaa tggaggagat
      961 caaggcagta caggcagcac cgaggatgcc gatgtgggcg ccaagcggaa gatggccttc
     1021 ctggacatcc tgctgcagtc gacgatcgac gagcggccgc tgagcaatct ggatatccgc
     1081 gaggaggtcg acaccttcat gttcgagggc cacgacacga cctcctcggc gctgatgttc
     1141 ctgttctaca acatagccac gcatccggag gcgcagaggc ggtgcttcga ggagatccga
     1201 tcggtaatgg gcgaggacag gagcactcca gtgacctacg agctgctgaa ccggctgcac
     1261 tacgtcgatc tgtgcgtgaa ggagacgctg cggatgtatc cctcggtgcc gctgctgggt
     1321 cgcaaggtgc tcgaggattg cgagataaat ggaaaactga taccggcggg caccaatatc
     1381 ggcatttcgc cactttacct cggcagacgc gaggagctct tcagcgagcc caatagcttc
     1441 aagccggagc gcttcgatgt ggtcaccacc gccgagaagc tcaatcccta tgcctacata
     1501 cccttctcgg ccggaccgcg caactgcatt ggccagaagt tcgccatgtt ggagatcaag
     1561 gccatcgcgg ccaatgtttt gcggcactac gaggttgact ttgtgggcga tacctcccag
     1621 ccgcccgtcc tcattgccga gctcattctg cgcaccaagg acccactgat gttcaaggtg
     1681 cgggagcgag tctactgaac ttgtaaataa tataaagtga atttattaga tcaaaaaccc
     1741 gccattttt