Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii SET and MYND domain containing,


LOCUS       XM_017140199            1629 bp    mRNA    linear   INV 09-DEC-2024
            arthropod-specific, member 8 (SmydA-8), transcript variant X2,
            mRNA.
ACCESSION   XM_017140199
VERSION     XM_017140199.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140199.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1629
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1629
                     /gene="SmydA-8"
                     /note="SET and MYND domain containing, arthropod-specific,
                     member 8; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108056417"
     CDS             67..1431
                     /gene="SmydA-8"
                     /codon_start=1
                     /product="SET domain-containing protein SmydA-8 isoform
                     X2"
                     /protein_id="XP_016995688.2"
                     /db_xref="GeneID:108056417"
                     /translation="MSNGAAGVPAKKEEEEPRSSKQMTISASTQELADLIDQHLGELR
                     QKEPSWRVADSPISGRGIFATRDIAPGEELFREHTLLVGPTAHRSTNLRTCTLCYRLI
                     PGSTDPEALCPAGCGLPVCSDCRSSQRHALECKLFRKWKPLESQRIEPRALRILSVVR
                     CFFLDEAGRKLLYAMQANMDRYYMQEVQRAADCFEHFPREQDMLDYFYRTICAFNTNA
                     FESRSSVGGHEVLVRALFPLAGLLNHQCTPNAAHHFENGETIVVCATERIPQGAEITM
                     TYAKLLWSTLARKIFLGMTKHFMCRCVRCQDPTENGTYLSALFCREQGCRSLVIPVQT
                     RTLQPDWRCITCENVFPHSKMAKYQDFALNTINNRINSCSVQDMIHFINEMCPRFCPS
                     SNYVLIEAKLNVIWRMTRFDREEYTPEEMGHMDRYREEVLAILHKLGAGECTLKKLIT
                     GEIQ"
     misc_feature    208..>282
                     /gene="SmydA-8"
                     /note="SET domain-containing protein (function unknown)
                     [General function prediction only]; Region: SET; COG2940"
                     /db_xref="CDD:442183"
     misc_feature    <697..981
                     /gene="SmydA-8"
                     /note="SET domain (including SET domain and post-SET
                     domain) found in SET and MYND domain-containing protein,
                     and similar proteins; Region: SET_SMYD; cd20071"
                     /db_xref="CDD:380997"
     misc_feature    order(715..720,754..756,784..798,898..900,904..906)
                     /gene="SmydA-8"
                     /note="active site"
                     /db_xref="CDD:380997"
     misc_feature    order(715..720,754..756,784..786,895..900,904..906)
                     /gene="SmydA-8"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:380997"
     misc_feature    order(802..804,964..966,970..972,979..981)
                     /gene="SmydA-8"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:380997"
     polyA_site      1629
                     /gene="SmydA-8"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcagttgcg tttcgttaat cggcggaatc gagagaaaga gttgcccttt tccacagccg
       61 atcgatatgt ccaacggtgc agctggtgtt cccgcgaaga aggaggagga ggagccgcga
      121 tcctcgaagc agatgaccat cagcgcctcc acgcaggagc tggccgacct gatagaccag
      181 cacctgggcg agctgcgcca gaaggagccc tcgtggcgcg tggccgactc gcccatttcc
      241 ggccgcggca tctttgccac ccgggacatt gcgcccggcg aggagctctt ccgggagcac
      301 acgctgctgg tgggtccgac cgcgcatcgg tccaccaatc tgcgcacctg caccctctgc
      361 taccgcctga tcccgggctc cacggacccc gaggccctct gtccggcggg ctgcgggctc
      421 ccagtttgct ccgactgccg cagctcccag cgtcacgcct tggagtgcaa gctcttcaga
      481 aagtggaagc cgctggagag ccagaggatc gagccgcgcg ccctgcggat cctcagcgtg
      541 gtgcgctgct tcttcctgga cgaagcgggc cgcaagctgc tctacgccat gcaggccaac
      601 atggatcgct actacatgca ggaggtccag cgggccgccg actgcttcga gcactttccg
      661 cgcgagcagg acatgctgga ctacttctac cgcaccatct gtgccttcaa cacgaacgcc
      721 ttcgagagcc ggagcagcgt tgggggccac gaggtgctgg tgagggccct cttcccgctg
      781 gcgggtctcc tcaaccacca gtgcaccccg aatgcggccc accacttcga gaacggcgag
      841 accatcgtgg tctgcgccac cgagcggatt ccccagggcg ccgagatcac catgacctat
      901 gccaagctgc tctggtcgac gctggcccga aagatattcc tcgggatgac caagcacttc
      961 atgtgcaggt gcgtccgttg ccaggatccc acggagaacg gaacctacct gtcggcgctc
     1021 ttctgccggg aacagggttg ccgcagcctg gtgattcccg tccagactcg caccctgcag
     1081 cccgactggc ggtgcatcac ctgcgagaac gtgtttccgc actcgaagat ggccaagtac
     1141 caggacttcg ccctgaacac catcaacaac cggatcaact cgtgcagcgt ccaggacatg
     1201 atccacttca tcaacgagat gtgcccgcgc ttctgtccct cctccaacta cgtgctcatc
     1261 gaggccaagc tgaacgtcat ctggcggatg acgaggttcg accgcgagga gtacaccccc
     1321 gaggagatgg gccacatgga tcggtatcgc gaggaggtcc tggccatcct ccacaagctg
     1381 ggcgccggcg agtgcaccct gaagaagctg atcaccgggg agattcagtg aacttgtgaa
     1441 tacttaagcg tttttttttt ttattcgcgt gtgaatgagc gagtgtttgt tgtgaatgaa
     1501 tgggttttgt ttgggccacg gggttaaacc tctgggccct ttgttgctat tttattcgta
     1561 gtcacttaag gaagaaaaca aataaacacc gaactatgtc tctttatgtt ggcccgtatt
     1621 ttcattgaa