Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140199 1629 bp mRNA linear INV 09-DEC-2024 arthropod-specific, member 8 (SmydA-8), transcript variant X2, mRNA. ACCESSION XM_017140199 VERSION XM_017140199.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140199.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1629 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1629 /gene="SmydA-8" /note="SET and MYND domain containing, arthropod-specific, member 8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056417" CDS 67..1431 /gene="SmydA-8" /codon_start=1 /product="SET domain-containing protein SmydA-8 isoform X2" /protein_id="XP_016995688.2" /db_xref="GeneID:108056417" /translation="MSNGAAGVPAKKEEEEPRSSKQMTISASTQELADLIDQHLGELR QKEPSWRVADSPISGRGIFATRDIAPGEELFREHTLLVGPTAHRSTNLRTCTLCYRLI PGSTDPEALCPAGCGLPVCSDCRSSQRHALECKLFRKWKPLESQRIEPRALRILSVVR CFFLDEAGRKLLYAMQANMDRYYMQEVQRAADCFEHFPREQDMLDYFYRTICAFNTNA FESRSSVGGHEVLVRALFPLAGLLNHQCTPNAAHHFENGETIVVCATERIPQGAEITM TYAKLLWSTLARKIFLGMTKHFMCRCVRCQDPTENGTYLSALFCREQGCRSLVIPVQT RTLQPDWRCITCENVFPHSKMAKYQDFALNTINNRINSCSVQDMIHFINEMCPRFCPS SNYVLIEAKLNVIWRMTRFDREEYTPEEMGHMDRYREEVLAILHKLGAGECTLKKLIT GEIQ" misc_feature 208..>282 /gene="SmydA-8" /note="SET domain-containing protein (function unknown) [General function prediction only]; Region: SET; COG2940" /db_xref="CDD:442183" misc_feature <697..981 /gene="SmydA-8" /note="SET domain (including SET domain and post-SET domain) found in SET and MYND domain-containing protein, and similar proteins; Region: SET_SMYD; cd20071" /db_xref="CDD:380997" misc_feature order(715..720,754..756,784..798,898..900,904..906) /gene="SmydA-8" /note="active site" /db_xref="CDD:380997" misc_feature order(715..720,754..756,784..786,895..900,904..906) /gene="SmydA-8" /note="polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:380997" misc_feature order(802..804,964..966,970..972,979..981) /gene="SmydA-8" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:380997" polyA_site 1629 /gene="SmydA-8" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcagttgcg tttcgttaat cggcggaatc gagagaaaga gttgcccttt tccacagccg 61 atcgatatgt ccaacggtgc agctggtgtt cccgcgaaga aggaggagga ggagccgcga 121 tcctcgaagc agatgaccat cagcgcctcc acgcaggagc tggccgacct gatagaccag 181 cacctgggcg agctgcgcca gaaggagccc tcgtggcgcg tggccgactc gcccatttcc 241 ggccgcggca tctttgccac ccgggacatt gcgcccggcg aggagctctt ccgggagcac 301 acgctgctgg tgggtccgac cgcgcatcgg tccaccaatc tgcgcacctg caccctctgc 361 taccgcctga tcccgggctc cacggacccc gaggccctct gtccggcggg ctgcgggctc 421 ccagtttgct ccgactgccg cagctcccag cgtcacgcct tggagtgcaa gctcttcaga 481 aagtggaagc cgctggagag ccagaggatc gagccgcgcg ccctgcggat cctcagcgtg 541 gtgcgctgct tcttcctgga cgaagcgggc cgcaagctgc tctacgccat gcaggccaac 601 atggatcgct actacatgca ggaggtccag cgggccgccg actgcttcga gcactttccg 661 cgcgagcagg acatgctgga ctacttctac cgcaccatct gtgccttcaa cacgaacgcc 721 ttcgagagcc ggagcagcgt tgggggccac gaggtgctgg tgagggccct cttcccgctg 781 gcgggtctcc tcaaccacca gtgcaccccg aatgcggccc accacttcga gaacggcgag 841 accatcgtgg tctgcgccac cgagcggatt ccccagggcg ccgagatcac catgacctat 901 gccaagctgc tctggtcgac gctggcccga aagatattcc tcgggatgac caagcacttc 961 atgtgcaggt gcgtccgttg ccaggatccc acggagaacg gaacctacct gtcggcgctc 1021 ttctgccggg aacagggttg ccgcagcctg gtgattcccg tccagactcg caccctgcag 1081 cccgactggc ggtgcatcac ctgcgagaac gtgtttccgc actcgaagat ggccaagtac 1141 caggacttcg ccctgaacac catcaacaac cggatcaact cgtgcagcgt ccaggacatg 1201 atccacttca tcaacgagat gtgcccgcgc ttctgtccct cctccaacta cgtgctcatc 1261 gaggccaagc tgaacgtcat ctggcggatg acgaggttcg accgcgagga gtacaccccc 1321 gaggagatgg gccacatgga tcggtatcgc gaggaggtcc tggccatcct ccacaagctg 1381 ggcgccggcg agtgcaccct gaagaagctg atcaccgggg agattcagtg aacttgtgaa 1441 tacttaagcg tttttttttt ttattcgcgt gtgaatgagc gagtgtttgt tgtgaatgaa 1501 tgggttttgt ttgggccacg gggttaaacc tctgggccct ttgttgctat tttattcgta 1561 gtcacttaag gaagaaaaca aataaacacc gaactatgtc tctttatgtt ggcccgtatt 1621 ttcattgaa