Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140196 1587 bp mRNA linear INV 09-DEC-2024 oenocytes (FarO), mRNA. ACCESSION XM_017140196 VERSION XM_017140196.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140196.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1587 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1587 /gene="FarO" /note="Fatty acyl-CoA reductase in oenocytes; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108056416" CDS 52..1542 /gene="FarO" /codon_start=1 /product="fatty acyl-CoA reductase wat" /protein_id="XP_016995685.2" /db_xref="GeneID:108056416" /translation="MEEFFKDSEIFVTGGSGVVGKALIEKLLRSCNVRRIYILLRPRR QLSAEERLLRLRQATVFHVLAVEKPQELDKIVAVPGDVSLPGLGIHPAMVEQMRGVSL VYHCAATVRFDEPLRVALRLNVGGTLEALRFAESLPQLRAFVHVSTFYSNPYLQRVEP KYYSSPMDWRLCLRLLEEVPDDGMLNALTRKLIVGFPNTYTFTKNLAESLVNDYRHRL PLIVYRPSIVLFAVDDPSPGFSPSLMGAMGLFALVGAGILKTVYLGRDIRLDITPQDI GIKSMLCYTKRGAEIYQKGPPAELPVYLSSSCTHVPHTFTQIAEQMDTLDLWRDVAFG KNLMIPGCHYTDRRWVYQLLVFTKQILPAMIIDLLLRTFGQKPVLMSAVRKAYQTLEV MQPFMFNNYDSPGVTDMELLSEENAGTPFNLDAFKHPDIHGLIIQSCGEMLLSIRTHL LREDPKTLGRSKIILRTKVFLYRLFRLFLLYKLILWIWRSYLSQFF" misc_feature 79..1011 /gene="FarO" /note="fatty acyl CoA reductases (FARs), extended (e) SDRs; Region: FAR-N_SDR_e; cd05236" /db_xref="CDD:187547" misc_feature order(91..93,97..108,169..177,367..375,424..426,487..495, 649..651,661..663,724..735) /gene="FarO" /note="putative NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187547" misc_feature order(427..429,493..495,649..651,661..663) /gene="FarO" /note="active site" /db_xref="CDD:187547" misc_feature order(493..495,649..651,730..732,766..768,814..816, 832..834) /gene="FarO" /note="putative substrate binding site [chemical binding]; other site" /db_xref="CDD:187547" misc_feature 1123..>1323 /gene="FarO" /note="Male sterility protein; Region: Sterile; pfam03015" /db_xref="CDD:460779" ORIGIN 1 tgcttagcgg gctgctctgg gcagtggatc accatccagt cacccagtcc aatggaggag 61 ttcttcaaag acagcgagat attcgtgacc ggcggctcgg gagtggtggg caaggcgctg 121 atcgagaagc tcctgcgctc ctgcaatgtg cgccgcatct acatcctgct gcgtcctcgc 181 cggcagctct cggcggagga gcggctcctc cgcctgcgcc aggcgaccgt cttccatgtc 241 ctggccgtgg agaagccgca ggaactggac aagatagtgg cggtgcccgg ggatgtctcc 301 ctgccgggac tgggcatcca tcccgcgatg gtggagcaaa tgcggggggt ttcgctggtc 361 taccactgcg ccgccaccgt tcgcttcgat gagccactgc gggtggcact ccgcctgaat 421 gtcggcggca ccctggaggc cctcaggttc gccgagagtc tgccgcagct gcgggccttc 481 gtccatgtgt ccaccttcta cagcaatccc tacttgcagc gggtggagcc caagtactac 541 tcctcgccga tggactggcg actgtgcctg cgactgcttg aggaggttcc agacgacggg 601 atgctcaatg cgctcacaag aaagctgatt gtgggcttcc cgaacacgta cacattcacc 661 aagaacctgg ccgagtccct ggtgaacgac taccgccatc gcctgccgct gatagtctac 721 cgtccatcca tagttctctt tgcggtggac gacccttcgc ctgggttttc gccctcactg 781 atgggcgcca tgggtctgtt cgccttggtg ggcgccggga ttctgaagac cgtttacctg 841 ggcagggaca tccggctgga catcacgccg caggacattg ggatcaagag catgctctgc 901 tacacgaagc ggggagccga gatctaccag aaaggtccgc cggcggagct gcccgtctat 961 ttatcctcat cctgcaccca tgtgccgcac accttcaccc agattgccga gcagatggac 1021 acgctggacc tgtggcgcga cgtggccttc gggaagaacc tgatgatacc gggctgtcac 1081 tacacggaca ggcggtgggt ctaccagctg ctggtcttca ccaagcagat cctgccggcc 1141 atgatcatcg acctgctgct gaggaccttc ggacagaagc ccgtgctcat gagtgccgtg 1201 cggaaggcct accagacgct ggaggtgatg cagcccttca tgttcaacaa ctacgacagt 1261 cccggggtca cggacatgga gctgctgtcc gaggagaacg ccggcacccc ctttaacttg 1321 gacgccttca agcacccgga catccatgga ctgatcatcc aatcctgcgg cgaaatgctc 1381 ctcagcatcc gaacgcattt gctacgcgag gatccaaaaa ctctgggccg ctccaagatt 1441 atcttgcgaa ctaaggtctt cctctaccgg ctgttccgcc tcttcctgct ctacaagctc 1501 atcctctgga tttggaggag ctacttgtcg cagttcttct agattagtgc cctctgattt 1561 tctagttgtt ataatttgtt ttttttt