Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140188 820 bp mRNA linear INV 09-DEC-2024 (LOC108056408), mRNA. ACCESSION XM_017140188 VERSION XM_017140188.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017140188.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..820 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..820 /gene="LOC108056408" /note="histidine-rich glycoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056408" CDS 58..540 /gene="LOC108056408" /codon_start=1 /product="histidine-rich glycoprotein" /protein_id="XP_016995677.2" /db_xref="GeneID:108056408" /translation="MDNRSLLLRLSIVVALVLLFVCVPETEAGSHQKKKKIVIHVPIH KKIEKHIHTVVKHVHHHHKPLVLKEEKKVIHEDHRPIQIHQTKEHIHHHEKHDHHDHH DHHDHHEHHHPLPPSVAPPALPELEEEEEHIHHHHNYEHRGGLRDDFIGGDGSSSEER " ORIGIN 1 gcaccgtcgg agccttcaac acctcagcac ctggacctgg atctctagcc aagcgatatg 61 gataaccgca gtttgctgct gaggctctcg attgtggtgg cgctggtctt gctgttcgtc 121 tgcgtcccgg aaacggaagc ggggagccac cagaaaaaga agaaaatcgt gatccacgtg 181 cccattcaca agaagatcga gaagcacata cacacggttg tgaagcacgt ccaccaccac 241 cacaaaccgc tcgttctgaa ggaggagaag aaggtgatcc acgaggacca tcgacccatc 301 cagatccacc agaccaagga gcacattcac caccacgaga agcacgacca ccacgaccat 361 cacgaccatc atgaccatca cgagcaccac cacccacttc cgccgtcggt ggcgccacct 421 gctctgccgg aactcgagga ggaggaggag cacatccacc accaccacaa ctacgagcac 481 aggggcggac tgcgggacga cttcatcggc ggcgatggga gcagcagcga ggagcgctga 541 ctatgtggcg cccaacgtgg ggcgcagact gatgcgatcc aatcgcccgg attgtcccga 601 ctctttgtga ttccctagat acgtacatac cctttttgtt tgtttttttt ttactagcct 661 aaatcgtagc ttaagtgtga atgaaaatgg aaatgcaggt aaatcggagt agggcgaatt 721 tagttttagg aaaatgtgaa aggcaaagat ctaagaaaga caaataacta gttttcagct 781 ttgccattat ttaataacgt aagctttaca aaatggtaga