Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii histidine-rich glycoprotein


LOCUS       XM_017140188             820 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056408), mRNA.
ACCESSION   XM_017140188
VERSION     XM_017140188.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017140188.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..820
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..820
                     /gene="LOC108056408"
                     /note="histidine-rich glycoprotein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108056408"
     CDS             58..540
                     /gene="LOC108056408"
                     /codon_start=1
                     /product="histidine-rich glycoprotein"
                     /protein_id="XP_016995677.2"
                     /db_xref="GeneID:108056408"
                     /translation="MDNRSLLLRLSIVVALVLLFVCVPETEAGSHQKKKKIVIHVPIH
                     KKIEKHIHTVVKHVHHHHKPLVLKEEKKVIHEDHRPIQIHQTKEHIHHHEKHDHHDHH
                     DHHDHHEHHHPLPPSVAPPALPELEEEEEHIHHHHNYEHRGGLRDDFIGGDGSSSEER
                     "
ORIGIN      
        1 gcaccgtcgg agccttcaac acctcagcac ctggacctgg atctctagcc aagcgatatg
       61 gataaccgca gtttgctgct gaggctctcg attgtggtgg cgctggtctt gctgttcgtc
      121 tgcgtcccgg aaacggaagc ggggagccac cagaaaaaga agaaaatcgt gatccacgtg
      181 cccattcaca agaagatcga gaagcacata cacacggttg tgaagcacgt ccaccaccac
      241 cacaaaccgc tcgttctgaa ggaggagaag aaggtgatcc acgaggacca tcgacccatc
      301 cagatccacc agaccaagga gcacattcac caccacgaga agcacgacca ccacgaccat
      361 cacgaccatc atgaccatca cgagcaccac cacccacttc cgccgtcggt ggcgccacct
      421 gctctgccgg aactcgagga ggaggaggag cacatccacc accaccacaa ctacgagcac
      481 aggggcggac tgcgggacga cttcatcggc ggcgatggga gcagcagcga ggagcgctga
      541 ctatgtggcg cccaacgtgg ggcgcagact gatgcgatcc aatcgcccgg attgtcccga
      601 ctctttgtga ttccctagat acgtacatac cctttttgtt tgtttttttt ttactagcct
      661 aaatcgtagc ttaagtgtga atgaaaatgg aaatgcaggt aaatcggagt agggcgaatt
      721 tagttttagg aaaatgtgaa aggcaaagat ctaagaaaga caaataacta gttttcagct
      781 ttgccattat ttaataacgt aagctttaca aaatggtaga