Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii E3 ubiquitin-protein ligase RNF128


LOCUS       XM_017140185             893 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056406), mRNA.
ACCESSION   XM_017140185
VERSION     XM_017140185.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140185.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..893
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..893
                     /gene="LOC108056406"
                     /note="E3 ubiquitin-protein ligase RNF128; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108056406"
     CDS             99..569
                     /gene="LOC108056406"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase RNF128"
                     /protein_id="XP_016995674.2"
                     /db_xref="GeneID:108056406"
                     /translation="MSYNNVICTICSERYRTSDNIHAGSCGHAFHEECLDRWREQSRT
                     CPICRCEDATYFQLYLNFEESPAGDSETAQSGSGRNRSQGHGGSSRSSSSNNSSNTSS
                     SDYAGIMREYENLLYETGVYQDEIEYLNERIGALTLRNSRLCKLHGDDSDSDDD"
     misc_feature    117..245
                     /gene="LOC108056406"
                     /note="RING finger (Really Interesting New Gene) domain
                     and U-box domain superfamily; Region: RING_Ubox; cl17238"
                     /db_xref="CDD:473075"
     misc_feature    order(120..122,129..131,174..176,180..182,189..191,
                     198..200,231..233,240..242)
                     /gene="LOC108056406"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:438111"
ORIGIN      
        1 tcagtgcgcc gccaccggcc gagcagttta acacggcgtc gggcgatcga atcgaatcgg
       61 atcgaatcaa attagcaaat tagcaaaatc aaaacgaaat gagctataac aacgtgatct
      121 gcacgatctg ttcggagcgg tatcgcacct cggacaacat acacgccggc agctgtgggc
      181 atgccttcca cgaggagtgc ctggaccgct ggcgggagca atcgagaact tgccccatct
      241 gccgctgcga ggatgccacg tacttccagc tctatctgaa cttcgaggag tcgccggcag
      301 gcgacagcga gacggcgcag agtggaagtg ggcgaaatcg gagccaaggt cacggcggca
      361 gcagtcgcag cagcagcagc aacaacagca gcaacacgag cagcagcgat tacgcgggca
      421 tcatgaggga gtacgagaac ctgctctacg agacgggggt gtaccaggat gagatcgagt
      481 atctcaacga gcggatcggg gcgctcaccc tccgcaattc tcgactctgc aagttgcacg
      541 gcgacgattc ggattcggac gatgattagg agcagcgcag ccagggaata caaacaaaca
      601 aaagagccgc tgtaaacatt gggttatcgc acatttcgcc agaggatccc ggcgatagcc
      661 gatcgaatcc aagtaacaaa ctatttggac agataagcag actcagaagg ctgagggaaa
      721 caaaagaggc gaaagaacaa tagagccagt acatgtgagt gctcatatgc gataaataaa
      781 tgattactaa gagaagatac atataagata tgatatgtta gactaaataa agcaataaga
      841 aaaaatacgt ttaggcaacg taaaattagc tatttaataa ccaaaataaa tca