Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140185 893 bp mRNA linear INV 09-DEC-2024 (LOC108056406), mRNA. ACCESSION XM_017140185 VERSION XM_017140185.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140185.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..893 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..893 /gene="LOC108056406" /note="E3 ubiquitin-protein ligase RNF128; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056406" CDS 99..569 /gene="LOC108056406" /codon_start=1 /product="E3 ubiquitin-protein ligase RNF128" /protein_id="XP_016995674.2" /db_xref="GeneID:108056406" /translation="MSYNNVICTICSERYRTSDNIHAGSCGHAFHEECLDRWREQSRT CPICRCEDATYFQLYLNFEESPAGDSETAQSGSGRNRSQGHGGSSRSSSSNNSSNTSS SDYAGIMREYENLLYETGVYQDEIEYLNERIGALTLRNSRLCKLHGDDSDSDDD" misc_feature 117..245 /gene="LOC108056406" /note="RING finger (Really Interesting New Gene) domain and U-box domain superfamily; Region: RING_Ubox; cl17238" /db_xref="CDD:473075" misc_feature order(120..122,129..131,174..176,180..182,189..191, 198..200,231..233,240..242) /gene="LOC108056406" /note="cross-brace motif; other site" /db_xref="CDD:438111" ORIGIN 1 tcagtgcgcc gccaccggcc gagcagttta acacggcgtc gggcgatcga atcgaatcgg 61 atcgaatcaa attagcaaat tagcaaaatc aaaacgaaat gagctataac aacgtgatct 121 gcacgatctg ttcggagcgg tatcgcacct cggacaacat acacgccggc agctgtgggc 181 atgccttcca cgaggagtgc ctggaccgct ggcgggagca atcgagaact tgccccatct 241 gccgctgcga ggatgccacg tacttccagc tctatctgaa cttcgaggag tcgccggcag 301 gcgacagcga gacggcgcag agtggaagtg ggcgaaatcg gagccaaggt cacggcggca 361 gcagtcgcag cagcagcagc aacaacagca gcaacacgag cagcagcgat tacgcgggca 421 tcatgaggga gtacgagaac ctgctctacg agacgggggt gtaccaggat gagatcgagt 481 atctcaacga gcggatcggg gcgctcaccc tccgcaattc tcgactctgc aagttgcacg 541 gcgacgattc ggattcggac gatgattagg agcagcgcag ccagggaata caaacaaaca 601 aaagagccgc tgtaaacatt gggttatcgc acatttcgcc agaggatccc ggcgatagcc 661 gatcgaatcc aagtaacaaa ctatttggac agataagcag actcagaagg ctgagggaaa 721 caaaagaggc gaaagaacaa tagagccagt acatgtgagt gctcatatgc gataaataaa 781 tgattactaa gagaagatac atataagata tgatatgtta gactaaataa agcaataaga 841 aaaaatacgt ttaggcaacg taaaattagc tatttaataa ccaaaataaa tca