Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017140184             380 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056405), mRNA.
ACCESSION   XM_017140184
VERSION     XM_017140184.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140184.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..380
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..380
                     /gene="LOC108056405"
                     /note="uncharacterized LOC108056405; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108056405"
     CDS             89..301
                     /gene="LOC108056405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995673.1"
                     /db_xref="GeneID:108056405"
                     /translation="MQKKPINANSLLDKLHRGAVYACIGVTLYGTYILGMRYYHYYTV
                     IRPEKQQAELKLLDEGAHDKAKELKY"
     misc_feature    95..265
                     /gene="LOC108056405"
                     /note="Cytochrome oxidase c assembly; Region: COX14;
                     pfam14880"
                     /db_xref="CDD:434280"
     polyA_site      380
                     /gene="LOC108056405"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tacaccagcc attatcggaa gcactgacaa aacagctgac aaaactaaac ggaaattttg
       61 agatattttc cggacttgat tttccgccat gcagaagaag cccatcaacg ccaactcgct
      121 gctggacaag ctgcaccgcg gcgcagtgta cgcctgcatc ggcgtgaccc tctacggcac
      181 ctacatcctg gggatgcgct actaccacta ctacacggtc atccggccgg agaagcagca
      241 ggccgagctg aagctcctgg acgagggggc ccacgacaag gccaaggagc tgaagtacta
      301 ggacccaccc gcccattaat tgttaaatgt ctgttaagcg caataaattg taaggaaatg
      361 taagcatttt cagccgaaaa