Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140184 380 bp mRNA linear INV 09-DEC-2024 (LOC108056405), mRNA. ACCESSION XM_017140184 VERSION XM_017140184.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140184.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..380 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..380 /gene="LOC108056405" /note="uncharacterized LOC108056405; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056405" CDS 89..301 /gene="LOC108056405" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016995673.1" /db_xref="GeneID:108056405" /translation="MQKKPINANSLLDKLHRGAVYACIGVTLYGTYILGMRYYHYYTV IRPEKQQAELKLLDEGAHDKAKELKY" misc_feature 95..265 /gene="LOC108056405" /note="Cytochrome oxidase c assembly; Region: COX14; pfam14880" /db_xref="CDD:434280" polyA_site 380 /gene="LOC108056405" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tacaccagcc attatcggaa gcactgacaa aacagctgac aaaactaaac ggaaattttg 61 agatattttc cggacttgat tttccgccat gcagaagaag cccatcaacg ccaactcgct 121 gctggacaag ctgcaccgcg gcgcagtgta cgcctgcatc ggcgtgaccc tctacggcac 181 ctacatcctg gggatgcgct actaccacta ctacacggtc atccggccgg agaagcagca 241 ggccgagctg aagctcctgg acgagggggc ccacgacaag gccaaggagc tgaagtacta 301 ggacccaccc gcccattaat tgttaaatgt ctgttaagcg caataaattg taaggaaatg 361 taagcatttt cagccgaaaa