Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii keratin-associated protein 19-3


LOCUS       XM_017140182             448 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056402), mRNA.
ACCESSION   XM_017140182
VERSION     XM_017140182.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140182.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..448
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..448
                     /gene="LOC108056402"
                     /note="keratin-associated protein 19-3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056402"
     CDS             83..409
                     /gene="LOC108056402"
                     /codon_start=1
                     /product="keratin-associated protein 19-3"
                     /protein_id="XP_016995671.2"
                     /db_xref="GeneID:108056402"
                     /translation="MKFLCVFVILAICLVGTWAAVAEPAPEALEPEPESAAVDEKKTE
                     KRGIYGFGHGYGGYGGYGGYGHGHYGGYGLGSPYYGGYGYVHAAPYYGGHHGYYPYHH
                     GHYGFY"
ORIGIN      
        1 ccaacccatc gagtcaactc gcaaccgagc aatctctagc aatccagtaa tccggcaatc
       61 cagcaacatc tgcagcagca acatgaagtt cttgtgtgta ttcgtcatcc tggccatttg
      121 tctggtgggc acctgggcag cagttgcgga acccgctccc gaggccctgg aaccggagcc
      181 cgagtcggcg gccgtggatg agaagaagac ggagaagagg ggcatctacg gatttggcca
      241 cggatatgga ggctacggag gatacggcgg atacggacat ggtcactacg gcggctatgg
      301 actgggcagc ccctactacg gcggctacgg atacgtccat gcggcgccct actacggcgg
      361 acaccacggc tactatccgt accaccatgg gcactacggc ttctactagg tacaccacct
      421 gtccatgatc ataatacata ctgttttt