Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140182 448 bp mRNA linear INV 09-DEC-2024 (LOC108056402), mRNA. ACCESSION XM_017140182 VERSION XM_017140182.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140182.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..448 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..448 /gene="LOC108056402" /note="keratin-associated protein 19-3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056402" CDS 83..409 /gene="LOC108056402" /codon_start=1 /product="keratin-associated protein 19-3" /protein_id="XP_016995671.2" /db_xref="GeneID:108056402" /translation="MKFLCVFVILAICLVGTWAAVAEPAPEALEPEPESAAVDEKKTE KRGIYGFGHGYGGYGGYGGYGHGHYGGYGLGSPYYGGYGYVHAAPYYGGHHGYYPYHH GHYGFY" ORIGIN 1 ccaacccatc gagtcaactc gcaaccgagc aatctctagc aatccagtaa tccggcaatc 61 cagcaacatc tgcagcagca acatgaagtt cttgtgtgta ttcgtcatcc tggccatttg 121 tctggtgggc acctgggcag cagttgcgga acccgctccc gaggccctgg aaccggagcc 181 cgagtcggcg gccgtggatg agaagaagac ggagaagagg ggcatctacg gatttggcca 241 cggatatgga ggctacggag gatacggcgg atacggacat ggtcactacg gcggctatgg 301 actgggcagc ccctactacg gcggctacgg atacgtccat gcggcgccct actacggcgg 361 acaccacggc tactatccgt accaccatgg gcactacggc ttctactagg tacaccacct 421 gtccatgatc ataatacata ctgttttt