Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140181 792 bp mRNA linear INV 09-DEC-2024 (LOC108056401), mRNA. ACCESSION XM_017140181 VERSION XM_017140181.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140181.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..792 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..792 /gene="LOC108056401" /note="period circadian protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056401" CDS 81..659 /gene="LOC108056401" /codon_start=1 /product="period circadian protein" /protein_id="XP_016995670.2" /db_xref="GeneID:108056401" /translation="MLKRDLQKITLKLSDLKDYEFAREQNKAKKAQRSRLSQDALAGD DASTSGTTASCSSNTGTATETASGSGSGSGSGSGSGSTSGSYITGLGLGYRSDTPSSA SYTNTTSTTPTPATQEEILRPSSAVTATTTTGTTNSGSTDDVSVAAVVDDTDTIDEIS DDNWVDLNADTNDTVDTHEVEEEEEDGARGGI" misc_feature 81..248 /gene="LOC108056401" /note="Anaphase-promoting complex APC subunit CDC26; Region: ANAPC_CDC26; pfam10471" /db_xref="CDD:402205" polyA_site 792 /gene="LOC108056401" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgagagcaa atgtaacata tgtaagctct cttcgaataa ctgttttctg atccacgctt 61 aaaattgttt ccaaataaag atgctaaaac gcgatctaca gaagattacg ctaaagctgt 121 ccgatctgaa ggactacgag tttgcccggg agcagaacaa agccaagaag gcacagcgat 181 ccaggttgtc ccaggatgcc ctagccggag atgatgcctc cacttcgggg acaacggcca 241 gttgcagttc caatacgggc acggcaacgg aaactgcatc gggatcgggt tcaggatcgg 301 gttcgggatc gggatcggga tcaacatctg gatcgtacat aacgggattg ggactgggct 361 accgatcgga tacaccctcc tcggcatcgt ataccaatac cacgtcgacg accccaactc 421 cggccaccca ggaggagata ctgagaccct cgtccgccgt cacggccacc accaccacgg 481 gcaccaccaa ttccgggtcc acggatgacg tgagcgtggc ggccgtggtg gatgatacgg 541 ataccattga cgagatcagc gacgacaact gggtggatct gaatgcggac accaacgata 601 ccgtcgatac ccacgaggtg gaggaggagg aggaggacgg ggccagggga ggcatctagg 661 aatcgccagg aattccggaa atccattatg caaacataaa gcagctgcaa ctgaagcacc 721 ccttatcatt ccatttatct acttattttc tattataata ataacctatt gcatgctcca 781 tttgcttacg ta