Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii period circadian protein


LOCUS       XM_017140181             792 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056401), mRNA.
ACCESSION   XM_017140181
VERSION     XM_017140181.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140181.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..792
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..792
                     /gene="LOC108056401"
                     /note="period circadian protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056401"
     CDS             81..659
                     /gene="LOC108056401"
                     /codon_start=1
                     /product="period circadian protein"
                     /protein_id="XP_016995670.2"
                     /db_xref="GeneID:108056401"
                     /translation="MLKRDLQKITLKLSDLKDYEFAREQNKAKKAQRSRLSQDALAGD
                     DASTSGTTASCSSNTGTATETASGSGSGSGSGSGSGSTSGSYITGLGLGYRSDTPSSA
                     SYTNTTSTTPTPATQEEILRPSSAVTATTTTGTTNSGSTDDVSVAAVVDDTDTIDEIS
                     DDNWVDLNADTNDTVDTHEVEEEEEDGARGGI"
     misc_feature    81..248
                     /gene="LOC108056401"
                     /note="Anaphase-promoting complex APC subunit CDC26;
                     Region: ANAPC_CDC26; pfam10471"
                     /db_xref="CDD:402205"
     polyA_site      792
                     /gene="LOC108056401"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgagagcaa atgtaacata tgtaagctct cttcgaataa ctgttttctg atccacgctt
       61 aaaattgttt ccaaataaag atgctaaaac gcgatctaca gaagattacg ctaaagctgt
      121 ccgatctgaa ggactacgag tttgcccggg agcagaacaa agccaagaag gcacagcgat
      181 ccaggttgtc ccaggatgcc ctagccggag atgatgcctc cacttcgggg acaacggcca
      241 gttgcagttc caatacgggc acggcaacgg aaactgcatc gggatcgggt tcaggatcgg
      301 gttcgggatc gggatcggga tcaacatctg gatcgtacat aacgggattg ggactgggct
      361 accgatcgga tacaccctcc tcggcatcgt ataccaatac cacgtcgacg accccaactc
      421 cggccaccca ggaggagata ctgagaccct cgtccgccgt cacggccacc accaccacgg
      481 gcaccaccaa ttccgggtcc acggatgacg tgagcgtggc ggccgtggtg gatgatacgg
      541 ataccattga cgagatcagc gacgacaact gggtggatct gaatgcggac accaacgata
      601 ccgtcgatac ccacgaggtg gaggaggagg aggaggacgg ggccagggga ggcatctagg
      661 aatcgccagg aattccggaa atccattatg caaacataaa gcagctgcaa ctgaagcacc
      721 ccttatcatt ccatttatct acttattttc tattataata ataacctatt gcatgctcca
      781 tttgcttacg ta