Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140180 751 bp mRNA linear INV 09-DEC-2024 (bcn92), mRNA. ACCESSION XM_017140180 VERSION XM_017140180.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140180.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..751 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..751 /gene="bcn92" /note="LYR motif-containing protein bcn92; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056400" CDS 206..484 /gene="bcn92" /codon_start=1 /product="protein bcn92" /protein_id="XP_016995669.2" /db_xref="GeneID:108056400" /translation="MSTRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRGI RDFGEIDRQMVEGQQNLELIRRQVIIGHLYSTEKLVIENKKTLKPSDD" misc_feature 221..427 /gene="bcn92" /note="LYR (leucine-tyrosine-arginine) motif found in LYR motif-containing protein 4 (LYRM4) and similar proteins; Region: Complex1_LYR_LYRM4; cd20264" /db_xref="CDD:380759" misc_feature order(224..229,302..307,314..319,326..331,353..355, 362..364,383..385,395..397) /gene="bcn92" /note="phosphopantetheine binding site [chemical binding]; other site" /db_xref="CDD:380759" misc_feature order(227..229,236..241,248..253,275..283,287..292, 299..304,308..313,320..322,329..331,392..394,401..406, 413..415) /gene="bcn92" /note="trimer interface [polypeptide binding]; other site" /db_xref="CDD:380759" polyA_site 751 /gene="bcn92" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccacatgtaa tttttatgtc atcaggcggt cggtccacca atccaatagg aaacaataac 61 cagggtcaaa acaaaacacg acgccggcgt tgacactcat caattaaagg gcgctccaaa 121 tctccgtctc catctcgagc cactccgctt gctcggttcc atttggccag gacaggatag 181 gattaggatc aggatcagaa tcaggatgtc gacgcgtcgc caggcgatca cgttatacag 241 gaatctcctg cgcgaatcgg agaagctgcc ctcctacaac ttcaggatgt acgctgcccg 301 caaaatacgc gacacattcc gtgccaacag gggcatccgg gatttcgggg agatcgaccg 361 gcaaatggtc gagggacagc agaatctgga gctgatacgt cgccaggtga tcatcgggca 421 tttgtacagc accgaaaagc tggtcataga gaacaagaag actctgaagc cctcggatga 481 ctgaggatcg gaagggctga aggtagctga agagagtaca atagcaggag gaggaggaaa 541 aggaggagga ggaggagcag gaggcgtctc tacatgagga cacaactcga aagactcgac 601 acacaaccac accaaccaca cacattgttg attttatacc ggcactttgc atccatcgaa 661 ccaaggaacc gaaatcattt gctagcaaaa aaaaacacca atttaatgtt atgttaaaca 721 agaaatatga aattatatat acatacatat a