Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii LYR motif-containing protein bcn92


LOCUS       XM_017140180             751 bp    mRNA    linear   INV 09-DEC-2024
            (bcn92), mRNA.
ACCESSION   XM_017140180
VERSION     XM_017140180.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140180.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..751
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..751
                     /gene="bcn92"
                     /note="LYR motif-containing protein bcn92; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056400"
     CDS             206..484
                     /gene="bcn92"
                     /codon_start=1
                     /product="protein bcn92"
                     /protein_id="XP_016995669.2"
                     /db_xref="GeneID:108056400"
                     /translation="MSTRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRGI
                     RDFGEIDRQMVEGQQNLELIRRQVIIGHLYSTEKLVIENKKTLKPSDD"
     misc_feature    221..427
                     /gene="bcn92"
                     /note="LYR (leucine-tyrosine-arginine) motif found in LYR
                     motif-containing protein 4 (LYRM4) and similar proteins;
                     Region: Complex1_LYR_LYRM4; cd20264"
                     /db_xref="CDD:380759"
     misc_feature    order(224..229,302..307,314..319,326..331,353..355,
                     362..364,383..385,395..397)
                     /gene="bcn92"
                     /note="phosphopantetheine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:380759"
     misc_feature    order(227..229,236..241,248..253,275..283,287..292,
                     299..304,308..313,320..322,329..331,392..394,401..406,
                     413..415)
                     /gene="bcn92"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:380759"
     polyA_site      751
                     /gene="bcn92"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccacatgtaa tttttatgtc atcaggcggt cggtccacca atccaatagg aaacaataac
       61 cagggtcaaa acaaaacacg acgccggcgt tgacactcat caattaaagg gcgctccaaa
      121 tctccgtctc catctcgagc cactccgctt gctcggttcc atttggccag gacaggatag
      181 gattaggatc aggatcagaa tcaggatgtc gacgcgtcgc caggcgatca cgttatacag
      241 gaatctcctg cgcgaatcgg agaagctgcc ctcctacaac ttcaggatgt acgctgcccg
      301 caaaatacgc gacacattcc gtgccaacag gggcatccgg gatttcgggg agatcgaccg
      361 gcaaatggtc gagggacagc agaatctgga gctgatacgt cgccaggtga tcatcgggca
      421 tttgtacagc accgaaaagc tggtcataga gaacaagaag actctgaagc cctcggatga
      481 ctgaggatcg gaagggctga aggtagctga agagagtaca atagcaggag gaggaggaaa
      541 aggaggagga ggaggagcag gaggcgtctc tacatgagga cacaactcga aagactcgac
      601 acacaaccac accaaccaca cacattgttg attttatacc ggcactttgc atccatcgaa
      661 ccaaggaacc gaaatcattt gctagcaaaa aaaaacacca atttaatgtt atgttaaaca
      721 agaaatatga aattatatat acatacatat a