Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ras-related protein Rap-2b


LOCUS       XM_017139978            1822 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056252), transcript variant X1, mRNA.
ACCESSION   XM_017139978
VERSION     XM_017139978.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139978.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1822
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1822
                     /gene="LOC108056252"
                     /note="ras-related protein Rap-2b; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108056252"
     CDS             685..1644
                     /gene="LOC108056252"
                     /codon_start=1
                     /product="ras-related protein Rap-2b"
                     /protein_id="XP_016995467.1"
                     /db_xref="GeneID:108056252"
                     /translation="MRGRHLRRRFSLQPSFMKDDNAEDKPKRDKVGRNNAVDDAIGPA
                     NARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDT
                     AGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGN
                     KIDLLADGETEREVEYATTESVVTVDWENGFVEASAASNENITQVFKELLAQAKITYN
                     LSPALRRRRQSLPQQIGNNGPGTPLHHHHHHSHHHHQSQQHHHNSGGGGSSASTSAAA
                     AAAASSSGGGSGGSHAPTPAQLQHLQRIQERSLGAKRNSCSIS"
     misc_feature    829..1404
                     /gene="LOC108056252"
                     /note="Ras - dorsal-ventral anterior localization
                     (Ras-dva) family; Region: Ras_dva; cd04147"
                     /db_xref="CDD:206714"
     misc_feature    844..867
                     /gene="LOC108056252"
                     /note="G1 box; other site"
                     /db_xref="CDD:206714"
     misc_feature    order(847..852,991..996)
                     /gene="LOC108056252"
                     /note="putative GDI interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206714"
     misc_feature    order(850..870,985..987,994..996,1162..1167,1171..1173,
                     1267..1272)
                     /gene="LOC108056252"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206714"
     misc_feature    order(865..870,907..909,913..915,934..939,976..981,
                     985..987,991..996,1273..1275)
                     /gene="LOC108056252"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206714"
     misc_feature    order(910..915,928..939)
                     /gene="LOC108056252"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206714"
     misc_feature    910..936
                     /gene="LOC108056252"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206714"
     misc_feature    916..918
                     /gene="LOC108056252"
                     /note="G2 box; other site"
                     /db_xref="CDD:206714"
     misc_feature    985..996
                     /gene="LOC108056252"
                     /note="G3 box; other site"
                     /db_xref="CDD:206714"
     misc_feature    order(991..1032,1042..1047)
                     /gene="LOC108056252"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206714"
     misc_feature    1162..1173
                     /gene="LOC108056252"
                     /note="G4 box; other site"
                     /db_xref="CDD:206714"
     misc_feature    1267..1275
                     /gene="LOC108056252"
                     /note="G5 box; other site"
                     /db_xref="CDD:206714"
ORIGIN      
        1 cagtggccaa catccagcca acagccaact aaacagtcca attttggcca gaaacaaaag
       61 agcatcatcc tggccgcaaa aacacgagcg cagaattcaa attcaagttc gaattcttct
      121 cgcttagagt gaacaatatt cttctttttt tttaaaaaac ttgtgcttct tctgtgtctc
      181 ttgagtgcaa attggaaaaa cttaatttac caaaaatata attaaaaagc cctaaattgt
      241 ttcggaaaga taactcctaa gaacaggtaa acacggggaa tttgccaagg aaattatcat
      301 catcggagtc acgtaattaa aacgaaacgt aagactcgag aaagaagagc aaatatttgc
      361 attttccggt ggaagggcgg aaagggaaaa acgctggcgg ggctaataat aaactaaggc
      421 cgaaggacta aggactaagg agccaacaac taccgacgac gaccgttaac gtggccataa
      481 cagtttgcca gttagcgcta cagttaccgc tacagttact gctccactta cactgactgc
      541 tgataataaa acgtcacaga ccgaatcgaa gaagaaaaaa agctgagcgc actgagcgaa
      601 aagcgaggag cgttcgtata catatatatc aacagtagtc aacaaggaca accaggacac
      661 cgaggaaact tcaaggattg caggatgcgg ggccgtcact tgcgtcgccg attcagcctg
      721 cagccctcgt tcatgaagga tgacaatgcc gaggataaac caaagcgtga caaagtgggc
      781 aggaataacg cggtcgacga tgccatcgga ccggccaacg cccgccacaa aatcgtcgtc
      841 atgggctctg ccaaggtggg caagacgtcg ataatcaccc agtttctgta caacacattc
      901 agcaccaaat acaagcggac catcgaggag atgcaccagg gcaacttctc catcgccggc
      961 gttagtctca ccctcgatat cctggacact gccggttcct atgagtttcc ggcgatgcgt
     1021 gctctttcta tatcctcggc ggatgctttc atcctggtct acgatgtcac cgatgccaca
     1081 acctttgaag aggtgcgcac aattcgcgac cagatccacg agacgaaggc caccactgca
     1141 gttcccattg tggttgttgg caacaagatc gatcttttag ccgatggaga aaccgaacgc
     1201 gaggttgagt acgccaccac agaatcggtg gtcactgtgg actgggagaa tgggtttgtg
     1261 gaggcctcgg ctgccagcaa tgagaacatc actcaggtgt tcaaggagct gctggcccaa
     1321 gcaaagatca cctacaatct gagtccggca ctgcgacgtc gccgccagtc gttgccgcaa
     1381 cagattggca acaatgggcc gggcaccccg ctgcaccacc atcaccacca cagccaccac
     1441 caccatcagt cgcagcagca ccaccacaac tccggcggcg gaggctcctc cgcctccacc
     1501 tcggcggcgg cggcagcagc agcgtcttca tccggcggcg gctccggtgg atcccatgcc
     1561 cccactccgg cccagctgca gcacctccag cgaatccagg agcggagtct gggcgccaag
     1621 cgcaactcgt gcagcatctc ctaagggagc aaggggaatc tccggggatt ctaaagtcgc
     1681 accacggcag ctaaagaaaa aaaacaacta atgctaaact aaaacggtct cctacaaaac
     1741 ggttttcaat acttctccaa taatgcaaaa aaaaaacaca aaatggttct tacttctacg
     1801 taaaccaatt accaaaaaga aa