Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139978 1822 bp mRNA linear INV 09-DEC-2024 (LOC108056252), transcript variant X1, mRNA. ACCESSION XM_017139978 VERSION XM_017139978.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139978.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1822 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1822 /gene="LOC108056252" /note="ras-related protein Rap-2b; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108056252" CDS 685..1644 /gene="LOC108056252" /codon_start=1 /product="ras-related protein Rap-2b" /protein_id="XP_016995467.1" /db_xref="GeneID:108056252" /translation="MRGRHLRRRFSLQPSFMKDDNAEDKPKRDKVGRNNAVDDAIGPA NARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDT AGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGN KIDLLADGETEREVEYATTESVVTVDWENGFVEASAASNENITQVFKELLAQAKITYN LSPALRRRRQSLPQQIGNNGPGTPLHHHHHHSHHHHQSQQHHHNSGGGGSSASTSAAA AAAASSSGGGSGGSHAPTPAQLQHLQRIQERSLGAKRNSCSIS" misc_feature 829..1404 /gene="LOC108056252" /note="Ras - dorsal-ventral anterior localization (Ras-dva) family; Region: Ras_dva; cd04147" /db_xref="CDD:206714" misc_feature 844..867 /gene="LOC108056252" /note="G1 box; other site" /db_xref="CDD:206714" misc_feature order(847..852,991..996) /gene="LOC108056252" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:206714" misc_feature order(850..870,985..987,994..996,1162..1167,1171..1173, 1267..1272) /gene="LOC108056252" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206714" misc_feature order(865..870,907..909,913..915,934..939,976..981, 985..987,991..996,1273..1275) /gene="LOC108056252" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206714" misc_feature order(910..915,928..939) /gene="LOC108056252" /note="putative effector interaction site [active]" /db_xref="CDD:206714" misc_feature 910..936 /gene="LOC108056252" /note="Switch I region; other site" /db_xref="CDD:206714" misc_feature 916..918 /gene="LOC108056252" /note="G2 box; other site" /db_xref="CDD:206714" misc_feature 985..996 /gene="LOC108056252" /note="G3 box; other site" /db_xref="CDD:206714" misc_feature order(991..1032,1042..1047) /gene="LOC108056252" /note="Switch II region; other site" /db_xref="CDD:206714" misc_feature 1162..1173 /gene="LOC108056252" /note="G4 box; other site" /db_xref="CDD:206714" misc_feature 1267..1275 /gene="LOC108056252" /note="G5 box; other site" /db_xref="CDD:206714" ORIGIN 1 cagtggccaa catccagcca acagccaact aaacagtcca attttggcca gaaacaaaag 61 agcatcatcc tggccgcaaa aacacgagcg cagaattcaa attcaagttc gaattcttct 121 cgcttagagt gaacaatatt cttctttttt tttaaaaaac ttgtgcttct tctgtgtctc 181 ttgagtgcaa attggaaaaa cttaatttac caaaaatata attaaaaagc cctaaattgt 241 ttcggaaaga taactcctaa gaacaggtaa acacggggaa tttgccaagg aaattatcat 301 catcggagtc acgtaattaa aacgaaacgt aagactcgag aaagaagagc aaatatttgc 361 attttccggt ggaagggcgg aaagggaaaa acgctggcgg ggctaataat aaactaaggc 421 cgaaggacta aggactaagg agccaacaac taccgacgac gaccgttaac gtggccataa 481 cagtttgcca gttagcgcta cagttaccgc tacagttact gctccactta cactgactgc 541 tgataataaa acgtcacaga ccgaatcgaa gaagaaaaaa agctgagcgc actgagcgaa 601 aagcgaggag cgttcgtata catatatatc aacagtagtc aacaaggaca accaggacac 661 cgaggaaact tcaaggattg caggatgcgg ggccgtcact tgcgtcgccg attcagcctg 721 cagccctcgt tcatgaagga tgacaatgcc gaggataaac caaagcgtga caaagtgggc 781 aggaataacg cggtcgacga tgccatcgga ccggccaacg cccgccacaa aatcgtcgtc 841 atgggctctg ccaaggtggg caagacgtcg ataatcaccc agtttctgta caacacattc 901 agcaccaaat acaagcggac catcgaggag atgcaccagg gcaacttctc catcgccggc 961 gttagtctca ccctcgatat cctggacact gccggttcct atgagtttcc ggcgatgcgt 1021 gctctttcta tatcctcggc ggatgctttc atcctggtct acgatgtcac cgatgccaca 1081 acctttgaag aggtgcgcac aattcgcgac cagatccacg agacgaaggc caccactgca 1141 gttcccattg tggttgttgg caacaagatc gatcttttag ccgatggaga aaccgaacgc 1201 gaggttgagt acgccaccac agaatcggtg gtcactgtgg actgggagaa tgggtttgtg 1261 gaggcctcgg ctgccagcaa tgagaacatc actcaggtgt tcaaggagct gctggcccaa 1321 gcaaagatca cctacaatct gagtccggca ctgcgacgtc gccgccagtc gttgccgcaa 1381 cagattggca acaatgggcc gggcaccccg ctgcaccacc atcaccacca cagccaccac 1441 caccatcagt cgcagcagca ccaccacaac tccggcggcg gaggctcctc cgcctccacc 1501 tcggcggcgg cggcagcagc agcgtcttca tccggcggcg gctccggtgg atcccatgcc 1561 cccactccgg cccagctgca gcacctccag cgaatccagg agcggagtct gggcgccaag 1621 cgcaactcgt gcagcatctc ctaagggagc aaggggaatc tccggggatt ctaaagtcgc 1681 accacggcag ctaaagaaaa aaaacaacta atgctaaact aaaacggtct cctacaaaac 1741 ggttttcaat acttctccaa taatgcaaaa aaaaaacaca aaatggttct tacttctacg 1801 taaaccaatt accaaaaaga aa