Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139966 704 bp mRNA linear INV 09-DEC-2024 Siva-like (LOC108056247), transcript variant X2, mRNA. ACCESSION XM_017139966 VERSION XM_017139966.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139966.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..704 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..704 /gene="LOC108056247" /note="apoptosis regulatory protein Siva-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056247" CDS 123..518 /gene="LOC108056247" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_016995455.2" /db_xref="GeneID:108056247" /translation="MLFDGAAGNGGGGQGQGQNGSSTGMDGQQGQEQQPQLCEQYQLL GDGTIMLRNLRADLSNPRLERHKSRCCQRQTLIHDICVNCTMDLCEECGYSCGECSKF ICRSCVTLFGNRLDEAEDPLCDRCQMFFA" ORIGIN 1 tttttaaaac gcagcaggcc ttgaaaacaa ttgttagatc ctattcagtt ttctcaaaat 61 tgttagccgg tcttgattga atttttattc tgagctcgaa caaaaaaaag aaaacaacga 121 aaatgctttt cgacggtgca gccggcaatg gaggaggagg acagggtcag ggccagaatg 181 gatcctccac tggaatggat ggtcagcagg gccaggagca gcagccccag ctgtgtgagc 241 agtaccagct gctcggcgac ggaaccatca tgctgcgcaa cctgcgagcc gacctgtcca 301 atccgcgcct ggagcgccac aagtcccgct gctgccagcg gcaaacgctc atccacgaca 361 tctgcgtcaa ctgcaccatg gatctctgcg aggagtgcgg ctattcctgc ggcgagtgct 421 ccaagttcat atgccgcagt tgcgtcacat tatttggtaa tcgtcttgat gaagccgaag 481 atcctttgtg cgaccgctgc cagatgtttt tcgcctagcg atctcgcctt tgccaaagga 541 tctcttggcc agaaaagaag aaaagcgcag ccattttcac catacagtca aatactgggg 601 aactactctc tcatcaacgt ggtgctcgtt aaattttaag ttctgaatca gtacaaattt 661 ggcacgtctc tcaaagaaca tagggcaatt acttttatat atat