Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii apoptosis regulatory protein


LOCUS       XM_017139966             704 bp    mRNA    linear   INV 09-DEC-2024
            Siva-like (LOC108056247), transcript variant X2, mRNA.
ACCESSION   XM_017139966
VERSION     XM_017139966.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139966.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..704
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..704
                     /gene="LOC108056247"
                     /note="apoptosis regulatory protein Siva-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108056247"
     CDS             123..518
                     /gene="LOC108056247"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_016995455.2"
                     /db_xref="GeneID:108056247"
                     /translation="MLFDGAAGNGGGGQGQGQNGSSTGMDGQQGQEQQPQLCEQYQLL
                     GDGTIMLRNLRADLSNPRLERHKSRCCQRQTLIHDICVNCTMDLCEECGYSCGECSKF
                     ICRSCVTLFGNRLDEAEDPLCDRCQMFFA"
ORIGIN      
        1 tttttaaaac gcagcaggcc ttgaaaacaa ttgttagatc ctattcagtt ttctcaaaat
       61 tgttagccgg tcttgattga atttttattc tgagctcgaa caaaaaaaag aaaacaacga
      121 aaatgctttt cgacggtgca gccggcaatg gaggaggagg acagggtcag ggccagaatg
      181 gatcctccac tggaatggat ggtcagcagg gccaggagca gcagccccag ctgtgtgagc
      241 agtaccagct gctcggcgac ggaaccatca tgctgcgcaa cctgcgagcc gacctgtcca
      301 atccgcgcct ggagcgccac aagtcccgct gctgccagcg gcaaacgctc atccacgaca
      361 tctgcgtcaa ctgcaccatg gatctctgcg aggagtgcgg ctattcctgc ggcgagtgct
      421 ccaagttcat atgccgcagt tgcgtcacat tatttggtaa tcgtcttgat gaagccgaag
      481 atcctttgtg cgaccgctgc cagatgtttt tcgcctagcg atctcgcctt tgccaaagga
      541 tctcttggcc agaaaagaag aaaagcgcag ccattttcac catacagtca aatactgggg
      601 aactactctc tcatcaacgt ggtgctcgtt aaattttaag ttctgaatca gtacaaattt
      661 ggcacgtctc tcaaagaaca tagggcaatt acttttatat atat