Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139965 865 bp mRNA linear INV 09-DEC-2024 Siva-like (LOC108056247), transcript variant X1, mRNA. ACCESSION XM_017139965 VERSION XM_017139965.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139965.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..865 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..865 /gene="LOC108056247" /note="apoptosis regulatory protein Siva-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108056247" CDS 112..669 /gene="LOC108056247" /codon_start=1 /product="apoptosis regulatory protein Siva-like isoform X1" /protein_id="XP_016995454.2" /db_xref="GeneID:108056247" /translation="MENMVQKKAVKRSRSADDDDANNNLTQRKIWVNQKMSDSNNPQK MKEVHEKTTKMLFDGAAGNGGGGQGQGQNGSSTGMDGQQGQEQQPQLCEQYQLLGDGT IMLRNLRADLSNPRLERHKSRCCQRQTLIHDICVNCTMDLCEECGYSCGECSKFICRS CVTLFGNRLDEAEDPLCDRCQMFFA" misc_feature <409..666 /gene="LOC108056247" /note="Cd27 binding protein (Siva); Region: Siva; pfam05458" /db_xref="CDD:283184" ORIGIN 1 cgggataaaa aacacaaatt tggaaaccaa ttggaagccc agaaaattgc ggataacaga 61 gttattttta tttattttat ttatttctcc gggcccatat atcacagtat catggaaaac 121 atggtccaga aaaaggcggt aaagcgatcg cgatcggcgg atgacgacga tgccaacaac 181 aatctcaccc agcggaaaat ctgggtgaac cagaagatga gtgattccaa caatcctcag 241 aaaatgaagg aggtccatga gaaaacaacg aaaatgcttt tcgacggtgc agccggcaat 301 ggaggaggag gacagggtca gggccagaat ggatcctcca ctggaatgga tggtcagcag 361 ggccaggagc agcagcccca gctgtgtgag cagtaccagc tgctcggcga cggaaccatc 421 atgctgcgca acctgcgagc cgacctgtcc aatccgcgcc tggagcgcca caagtcccgc 481 tgctgccagc ggcaaacgct catccacgac atctgcgtca actgcaccat ggatctctgc 541 gaggagtgcg gctattcctg cggcgagtgc tccaagttca tatgccgcag ttgcgtcaca 601 ttatttggta atcgtcttga tgaagccgaa gatcctttgt gcgaccgctg ccagatgttt 661 ttcgcctagc gatctcgcct ttgccaaagg atctcttggc cagaaaagaa gaaaagcgca 721 gccattttca ccatacagtc aaatactggg gaactactct ctcatcaacg tggtgctcgt 781 taaattttaa gttctgaatc agtacaaatt tggcacgtct ctcaaagaac atagggcaat 841 tacttttata tatatatttc ttttt