Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii apoptosis regulatory protein


LOCUS       XM_017139965             865 bp    mRNA    linear   INV 09-DEC-2024
            Siva-like (LOC108056247), transcript variant X1, mRNA.
ACCESSION   XM_017139965
VERSION     XM_017139965.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139965.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..865
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..865
                     /gene="LOC108056247"
                     /note="apoptosis regulatory protein Siva-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108056247"
     CDS             112..669
                     /gene="LOC108056247"
                     /codon_start=1
                     /product="apoptosis regulatory protein Siva-like isoform
                     X1"
                     /protein_id="XP_016995454.2"
                     /db_xref="GeneID:108056247"
                     /translation="MENMVQKKAVKRSRSADDDDANNNLTQRKIWVNQKMSDSNNPQK
                     MKEVHEKTTKMLFDGAAGNGGGGQGQGQNGSSTGMDGQQGQEQQPQLCEQYQLLGDGT
                     IMLRNLRADLSNPRLERHKSRCCQRQTLIHDICVNCTMDLCEECGYSCGECSKFICRS
                     CVTLFGNRLDEAEDPLCDRCQMFFA"
     misc_feature    <409..666
                     /gene="LOC108056247"
                     /note="Cd27 binding protein (Siva); Region: Siva;
                     pfam05458"
                     /db_xref="CDD:283184"
ORIGIN      
        1 cgggataaaa aacacaaatt tggaaaccaa ttggaagccc agaaaattgc ggataacaga
       61 gttattttta tttattttat ttatttctcc gggcccatat atcacagtat catggaaaac
      121 atggtccaga aaaaggcggt aaagcgatcg cgatcggcgg atgacgacga tgccaacaac
      181 aatctcaccc agcggaaaat ctgggtgaac cagaagatga gtgattccaa caatcctcag
      241 aaaatgaagg aggtccatga gaaaacaacg aaaatgcttt tcgacggtgc agccggcaat
      301 ggaggaggag gacagggtca gggccagaat ggatcctcca ctggaatgga tggtcagcag
      361 ggccaggagc agcagcccca gctgtgtgag cagtaccagc tgctcggcga cggaaccatc
      421 atgctgcgca acctgcgagc cgacctgtcc aatccgcgcc tggagcgcca caagtcccgc
      481 tgctgccagc ggcaaacgct catccacgac atctgcgtca actgcaccat ggatctctgc
      541 gaggagtgcg gctattcctg cggcgagtgc tccaagttca tatgccgcag ttgcgtcaca
      601 ttatttggta atcgtcttga tgaagccgaa gatcctttgt gcgaccgctg ccagatgttt
      661 ttcgcctagc gatctcgcct ttgccaaagg atctcttggc cagaaaagaa gaaaagcgca
      721 gccattttca ccatacagtc aaatactggg gaactactct ctcatcaacg tggtgctcgt
      781 taaattttaa gttctgaatc agtacaaatt tggcacgtct ctcaaagaac atagggcaat
      841 tacttttata tatatatttc ttttt