Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii cytochrome c oxidase assembly


LOCUS       XM_017139955             514 bp    mRNA    linear   INV 09-DEC-2024
            factor 6 homolog (LOC108056240), mRNA.
ACCESSION   XM_017139955
VERSION     XM_017139955.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139955.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..514
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..514
                     /gene="LOC108056240"
                     /note="cytochrome c oxidase assembly factor 6 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108056240"
     CDS             168..446
                     /gene="LOC108056240"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly factor 6 homolog"
                     /protein_id="XP_016995444.1"
                     /db_xref="GeneID:108056240"
                     /translation="MSFPDKAERTKCWSNRDEYWKCLDEHAPKHSSTSGEKVPAACQS
                     LRKLFEQSCPGQWVKHFDRKRTYEQFKEKMAQGYDPLEERVRAEKQAK"
     misc_feature    174..374
                     /gene="LOC108056240"
                     /note="Cytochrome oxidase c subunit VIb; Region: COX6B;
                     pfam02297"
                     /db_xref="CDD:426708"
     misc_feature    183..185
                     /gene="LOC108056240"
                     /note="Subunit VIb/I interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(195..197,204..206,378..380)
                     /gene="LOC108056240"
                     /note="Subunit VIb/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(243..245,249..263,291..293)
                     /gene="LOC108056240"
                     /note="Subunit VIb/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(357..359,366..374)
                     /gene="LOC108056240"
                     /note="Subunit VIb/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     polyA_site      514
                     /gene="LOC108056240"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cctgctattt tattaaattc cactgtttaa tggctggttt gttctgttaa agcggttgcc
       61 aaggccagaa gagtgggact gctacacgaa aaccagtcga aacccaagtg acggcgaaga
      121 ggagagtcgg aaaaccggaa accggctagg cgaaaacatc gaaaactatg agtttcccgg
      181 acaaggcgga gcgcaccaag tgctggagca atcgggacga gtactggaag tgcctggacg
      241 agcacgctcc gaagcacagc tccaccagcg gggagaaggt gcccgccgcc tgccaaagtc
      301 tgcgcaagct gttcgagcaa tcctgtcccg gccagtgggt caagcacttc gaccgcaagc
      361 gcacctacga gcagttcaag gagaagatgg cccagggcta cgatcctttg gaagagcgag
      421 tgcgggccga gaagcaggcc aagtgatgcg tgatttttgt actgttgtag ggtagtgtaa
      481 ataaatagcc catctagctg tatgacaaca agaa