Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139955 514 bp mRNA linear INV 09-DEC-2024 factor 6 homolog (LOC108056240), mRNA. ACCESSION XM_017139955 VERSION XM_017139955.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139955.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..514 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..514 /gene="LOC108056240" /note="cytochrome c oxidase assembly factor 6 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056240" CDS 168..446 /gene="LOC108056240" /codon_start=1 /product="cytochrome c oxidase assembly factor 6 homolog" /protein_id="XP_016995444.1" /db_xref="GeneID:108056240" /translation="MSFPDKAERTKCWSNRDEYWKCLDEHAPKHSSTSGEKVPAACQS LRKLFEQSCPGQWVKHFDRKRTYEQFKEKMAQGYDPLEERVRAEKQAK" misc_feature 174..374 /gene="LOC108056240" /note="Cytochrome oxidase c subunit VIb; Region: COX6B; pfam02297" /db_xref="CDD:426708" misc_feature 183..185 /gene="LOC108056240" /note="Subunit VIb/I interface [polypeptide binding]; other site" /db_xref="CDD:238466" misc_feature order(195..197,204..206,378..380) /gene="LOC108056240" /note="Subunit VIb/III interface [polypeptide binding]; other site" /db_xref="CDD:238466" misc_feature order(243..245,249..263,291..293) /gene="LOC108056240" /note="Subunit VIb/VIb interface [polypeptide binding]; other site" /db_xref="CDD:238466" misc_feature order(357..359,366..374) /gene="LOC108056240" /note="Subunit VIb/VIa interface [polypeptide binding]; other site" /db_xref="CDD:238466" polyA_site 514 /gene="LOC108056240" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cctgctattt tattaaattc cactgtttaa tggctggttt gttctgttaa agcggttgcc 61 aaggccagaa gagtgggact gctacacgaa aaccagtcga aacccaagtg acggcgaaga 121 ggagagtcgg aaaaccggaa accggctagg cgaaaacatc gaaaactatg agtttcccgg 181 acaaggcgga gcgcaccaag tgctggagca atcgggacga gtactggaag tgcctggacg 241 agcacgctcc gaagcacagc tccaccagcg gggagaaggt gcccgccgcc tgccaaagtc 301 tgcgcaagct gttcgagcaa tcctgtcccg gccagtgggt caagcacttc gaccgcaagc 361 gcacctacga gcagttcaag gagaagatgg cccagggcta cgatcctttg gaagagcgag 421 tgcgggccga gaagcaggcc aagtgatgcg tgatttttgt actgttgtag ggtagtgtaa 481 ataaatagcc catctagctg tatgacaaca agaa