PREDICTED: Drosophila takahashii lethal of scute (l(1)sc), mRNA.

LOCUS       XM_017139937            1047 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139937
VERSION     XM_017139937.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017139937.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1047
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1047
                     /gene="l(1)sc"
                     /note="lethal of scute; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 9 Proteins"
                     /db_xref="GeneID:108056223"
     CDS             54..869
                     /gene="l(1)sc"
                     /codon_start=1
                     /product="achaete-scute complex protein T3"
                     /protein_id="XP_016995426.2"
                     /db_xref="GeneID:108056223"
                     /translation="MTSICSSNFQQQHYQLTNGNISNMLLQHQSNFNQNHQIQQQQQH
                     QLIAPKMPLGTSQLQNQQQSSNIGPIMSSSQKQKKFNYNNMPYGEQLPSVARRNARER
                     NRVKQVNNGFVNLRQHLPQTVINSLSNGGRGASKKLSKVDTLRIAVEYIRGLQDMLDD
                     GTGTSTRHIYNSADESSNDGSSSYNDYNDSLDSSPQEFLLNQLKNSMPAAHSYHSASP
                     TPSSYSGSEISGGGYVKQELPEQDLKFESFDSFSDEQPDDEELLDYISSWQEQ"
     misc_feature    360..527
                     /gene="l(1)sc"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     Drosophila melanogaster achaete-scute complex (AS-C)
                     proteins and similar proteins; Region: bHLH_TS_dAS-C_like;
                     cd19744"
                     /db_xref="CDD:381587"
     misc_feature    order(372..377,384..389,393..398,474..476,483..485,
                     495..497,501..506,516..518,522..527)
                     /gene="l(1)sc"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381587"
     polyA_site      1047
                     /gene="l(1)sc"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccacacagt caacatctcc aactattaaa aactatctct cgcaaggatt accatgacga
       61 gcatctgcag cagcaacttc cagcagcagc actatcagct gaccaacggc aacatcagca
      121 acatgttgct gcagcaccag agcaacttta atcagaatca ccagattcag cagcagcagc
      181 aacaccagct gattgccccc aaaatgccgc tgggcaccag ccaattgcag aatcagcagc
      241 aatcatcgaa cattggaccg attatgtcct cctcgcagaa gcagaagaag ttcaactaca
      301 ataatatgcc ctatggcgag caattgcctt cggtggccag gcgaaatgcc cgcgaacgca
      361 atcgtgtcaa gcaggtgaac aatgggttcg tcaatcttcg ccagcatttg ccacaaacgg
      421 tgatcaattc gctgtcgaac ggaggacgcg gtgccagcaa gaagctctcc aaggtggaca
      481 ccctgcgcat tgccgtcgaa tatatccgtg gactgcagga catgctggac gatggcactg
      541 gaactagcac tcgtcacatt tacaactcgg ccgatgagag cagcaacgat ggcagcagct
      601 cgtacaacga ttacaacgat agtttggata gcagtccgca ggagtttctc cttaaccaac
      661 tgaagaactc tatgcccgct gctcactcct atcactccgc ctcgccaacg ccctcgtcgt
      721 attccggatc cgaaatctcc ggcggtggct atgtcaagca ggagctgccc gaacaggatc
      781 tgaaattcga gtccttcgac agcttcagcg acgagcagcc cgacgatgag gagctcctcg
      841 actacatttc atcctggcag gagcagtaaa tgagtggatc tcaacgaata tgcctaaccc
      901 taaaaaagaa aaaccaaaaa acttgtacaa attgtaaata actcaaattg ttgccttagt
      961 gagattctaa aacccccctc attttttttt gacactagtt taagacccca tggaagacaa
     1021 tgatataaaa catatatttt tttcata