PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017139935             300 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056222), mRNA.
ACCESSION   XM_017139935
VERSION     XM_017139935.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139935.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 8% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..300
                     /gene="LOC108056222"
                     /note="uncharacterized LOC108056222; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056222"
     CDS             1..300
                     /gene="LOC108056222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995424.2"
                     /db_xref="GeneID:108056222"
                     /translation="MRFTLLAIFLFGVLLAVVSAGGNGGGGGGGWQKGGGGGGGGGSQ
                     GGWQKGGGGGGGQGGWQKGGGGGGGGGKHGGGGNGGGGKHGGGGGGGGGKHGGGW"
ORIGIN      
        1 atgcgtttca ctctgctcgc aatcttcctc ttcggagtgc tcctggccgt cgtttccgcc
       61 ggcggaaatg gtggtggtgg cggcggtggc tggcaaaagg gtggtggcgg cggaggagga
      121 ggtggttccc aaggaggctg gcagaagggc ggcggcggag gaggtggcca agggggctgg
      181 cagaagggcg gcggcggcgg aggaggcggt ggaaagcacg gcggcggtgg aaatggaggt
      241 ggcggcaagc atggcggcgg cggaggagga ggtggtggaa agcacggcgg cggttggtaa