PREDICTED: Drosophila takahashii Translocase of inner membrane 9b

LOCUS       XM_017139839             474 bp    mRNA    linear   INV 09-DEC-2024
            (Tim9b), mRNA.
ACCESSION   XM_017139839
VERSION     XM_017139839.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139839.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..474
                     /gene="Tim9b"
                     /note="Translocase of inner membrane 9b; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:108056144"
     CDS             124..474
                     /gene="Tim9b"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim10B"
                     /protein_id="XP_016995328.1"
                     /db_xref="GeneID:108056144"
                     /translation="MDPNLRNLKDFLTLYNKVTELCFSRCVDNLSQRDLGGQEDMCVD
                     RCVTKFARFNQNMMKVYVDVQTTINAKRVEEVEENARKLEQQQKEQRLKEAAAATTTV
                     LTPVQPPVAGNLSM"
     misc_feature    133..306
                     /gene="Tim9b"
                     /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP;
                     pfam02953"
                     /db_xref="CDD:460764"
ORIGIN      
        1 aacaccgata tatcacacat aattgctcat cgataacagg tgaatcggta tcgggtggtt
       61 gaaagtaaag ttaaaaaatt aaattgtgta attgctgtat gaaaacacca gcccgctcgc
      121 ccgatggatc ccaatttgcg taacctcaag gactttctca ccttatacaa caaagtgacg
      181 gaactgtgct tcagccgatg cgtggataat ctcagccagc gcgacctggg cggccaggag
      241 gacatgtgcg tggacaggtg cgtcaccaag ttcgcccgct tcaatcagaa tatgatgaag
      301 gtctatgtgg atgtgcagac gacgattaat gccaagcgcg tggaggaggt ggaggagaac
      361 gcccgcaagt tggagcagca gcagaaggag cagcgactga aagaggcggc cgccgccacc
      421 accacagtgc tcactcccgt ccaaccgccc gtcgccggca acctgtccat gtag