Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii coiled-coil domain-containing


LOCUS       XM_017139838             562 bp    mRNA    linear   INV 09-DEC-2024
            protein 86 (LOC108056143), mRNA.
ACCESSION   XM_017139838
VERSION     XM_017139838.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139838.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..562
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..562
                     /gene="LOC108056143"
                     /note="coiled-coil domain-containing protein 86; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056143"
     CDS             74..496
                     /gene="LOC108056143"
                     /codon_start=1
                     /product="coiled-coil domain-containing protein 86"
                     /protein_id="XP_016995327.2"
                     /db_xref="GeneID:108056143"
                     /translation="MSEAAPETAPPKTPAKAKKAAKPENSIPRGQPKSNRPWKTPKQK
                     FSKIKKTINRATFEKKAALRDELRYIKERSKEIKTKRKEDAVQKHQRRVENAERRLAN
                     ERRSEVVQVIKNPAKLKRMKKKAMRMIQKRDTSQVKVV"
     misc_feature    155..457
                     /gene="LOC108056143"
                     /note="Cgr1 family; Region: Cgr1; pfam03879"
                     /db_xref="CDD:427562"
     polyA_site      562
                     /gene="LOC108056143"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gatacacgca gccaggcaac acgtgcgttc ttgttttgta tttttgtgtt gtttgagcat
       61 cgtaattccc gaaatgagtg aagccgcccc agaaacagcg ccgcccaaga cgccggcgaa
      121 ggccaagaag gcggcgaagc ccgagaacag cattccccgt ggccagccca agtccaaccg
      181 gccgtggaag acgcccaaac agaaattcag caagatcaag aagaccatta accgtgcgac
      241 gttcgagaag aaggccgctc tgcgcgacga gctgcgctac atcaaggagc gctccaagga
      301 gatcaagacg aagcgcaagg aggacgccgt ccagaagcat cagcgtcgcg tggagaacgc
      361 cgagcggcgg ctggccaacg agcgccgctc ggaggtcgtc caggtgatca agaatcccgc
      421 caagctgaag cgcatgaaga agaaggcgat gcgcatgatc cagaaaaggg acaccagcca
      481 ggtgaaggtg gtctaagcga acggggtcct aaagttaact tgtatttttt tcactaaata
      541 aatctagttt taattcaaat aa