Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139837 885 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017139837 VERSION XM_017139837.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139837.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..885 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..885 /gene="Pstk" /note="Phosphoseryl tRNA kinase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108056142" CDS 1..822 /gene="Pstk" /codon_start=1 /product="L-seryl-tRNA(Sec) kinase" /protein_id="XP_016995326.2" /db_xref="GeneID:108056142" /translation="MQCICLVALIGLPGAGKSTLCTWLLGQQAALLHFRHIVHLCYDD FLDIRLPYKEQRGLILNLLEQLIAAIQADTIWPAQIQRIAFSSSGKHILILCDDNFYY RSMRQQLQQLCRRSNGCIYGQLHIASSLDVCLTKNSKRSGGFRVPAAVIRQMNERLEA PGCEAWERNSLTIHNLNDKDAILDFINSLPAKESSPSSTNSRQPAQEQTLIHKLDLLL RARIKELLNDVKEKQLAGSRLNNKRKEILTRWRGEQRNGQAENEAALDYYVNLLN" misc_feature 10..774 /gene="Pstk" /note="Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates...; Region: NK; cl17190" /db_xref="CDD:450170" misc_feature order(31..33,46..57) /gene="Pstk" /note="active site" /db_xref="CDD:238977" polyA_site 885 /gene="Pstk" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgcagtgca tttgcctagt tgctctgatc ggcctgccag gagcgggcaa atccacgctt 61 tgcacctggc tgctaggcca acaggctgcc ctcctccact ttcgccacat tgttcacctg 121 tgctacgacg atttcctgga catccgactg ccctacaagg agcagcgcgg gcttatcctt 181 aacctactag aacaactcat agccgctatt caagcagaca ccatttggcc ggctcaaata 241 cagcgcattg cctttagcag cagtggaaaa cacattctaa tcttgtgcga cgacaacttt 301 tactaccgca gcatgcgcca acagctgcag cagctgtgtc gccgcagtaa tggctgcatc 361 tacggtcagc tacacatcgc cagttcgctg gacgtctgcc tgacgaagaa ctccaagaga 421 agcggcggtt tccgagtgcc ggcggctgtg attaggcaga tgaacgagcg actggaggcc 481 ccaggctgcg aggcctggga acgaaacagt ttaacaatcc acaacctaaa tgataaggat 541 gctatacttg attttattaa ttcactacct gcaaaggagt catcgccatc gtctacaaac 601 agcaggcagc ctgcgcagga acagacactc atccacaaac tggatcttct cctgcgagcg 661 cgtattaaag agctgctcaa tgatgtgaag gagaagcaac tggcgggcag tagattaaac 721 aacaagcgga aggagatatt aacaaggtgg cggggtgaac agagaaacgg acaggctgag 781 aatgaggctg ccttggatta ctatgtaaat ttgttaaact agcctataag ataagctaaa 841 ttcgtttgta ctaaatacat atataaaatg ttatttgaat taaaa