Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Phosphoseryl tRNA kinase (Pstk),


LOCUS       XM_017139837             885 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017139837
VERSION     XM_017139837.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139837.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..885
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..885
                     /gene="Pstk"
                     /note="Phosphoseryl tRNA kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108056142"
     CDS             1..822
                     /gene="Pstk"
                     /codon_start=1
                     /product="L-seryl-tRNA(Sec) kinase"
                     /protein_id="XP_016995326.2"
                     /db_xref="GeneID:108056142"
                     /translation="MQCICLVALIGLPGAGKSTLCTWLLGQQAALLHFRHIVHLCYDD
                     FLDIRLPYKEQRGLILNLLEQLIAAIQADTIWPAQIQRIAFSSSGKHILILCDDNFYY
                     RSMRQQLQQLCRRSNGCIYGQLHIASSLDVCLTKNSKRSGGFRVPAAVIRQMNERLEA
                     PGCEAWERNSLTIHNLNDKDAILDFINSLPAKESSPSSTNSRQPAQEQTLIHKLDLLL
                     RARIKELLNDVKEKQLAGSRLNNKRKEILTRWRGEQRNGQAENEAALDYYVNLLN"
     misc_feature    10..774
                     /gene="Pstk"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:450170"
     misc_feature    order(31..33,46..57)
                     /gene="Pstk"
                     /note="active site"
                     /db_xref="CDD:238977"
     polyA_site      885
                     /gene="Pstk"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgcagtgca tttgcctagt tgctctgatc ggcctgccag gagcgggcaa atccacgctt
       61 tgcacctggc tgctaggcca acaggctgcc ctcctccact ttcgccacat tgttcacctg
      121 tgctacgacg atttcctgga catccgactg ccctacaagg agcagcgcgg gcttatcctt
      181 aacctactag aacaactcat agccgctatt caagcagaca ccatttggcc ggctcaaata
      241 cagcgcattg cctttagcag cagtggaaaa cacattctaa tcttgtgcga cgacaacttt
      301 tactaccgca gcatgcgcca acagctgcag cagctgtgtc gccgcagtaa tggctgcatc
      361 tacggtcagc tacacatcgc cagttcgctg gacgtctgcc tgacgaagaa ctccaagaga
      421 agcggcggtt tccgagtgcc ggcggctgtg attaggcaga tgaacgagcg actggaggcc
      481 ccaggctgcg aggcctggga acgaaacagt ttaacaatcc acaacctaaa tgataaggat
      541 gctatacttg attttattaa ttcactacct gcaaaggagt catcgccatc gtctacaaac
      601 agcaggcagc ctgcgcagga acagacactc atccacaaac tggatcttct cctgcgagcg
      661 cgtattaaag agctgctcaa tgatgtgaag gagaagcaac tggcgggcag tagattaaac
      721 aacaagcgga aggagatatt aacaaggtgg cggggtgaac agagaaacgg acaggctgag
      781 aatgaggctg ccttggatta ctatgtaaat ttgttaaact agcctataag ataagctaaa
      841 ttcgtttgta ctaaatacat atataaaatg ttatttgaat taaaa