Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139825 654 bp mRNA linear INV 09-DEC-2024 S25 (mRpS25), mRNA. ACCESSION XM_017139825 VERSION XM_017139825.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139825.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..654 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..654 /gene="mRpS25" /note="mitochondrial ribosomal protein S25; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056134" CDS 102..605 /gene="mRpS25" /codon_start=1 /product="small ribosomal subunit protein mS25" /protein_id="XP_016995314.2" /db_xref="GeneID:108056134" /translation="MPFMKGREPIRRTLKYLNAGKLVLKDKVRIFSVNYNTYGDHHAG ARDFVFWNIPQIQFKNPEVQVLTLKNMTPSPFVRCYFEDGRDMLIDVDGRNRDEIIEH LVQVVGKTRETLDAEARLKESKDNPANFGYGCGRHCICEIPGQVACPGTVPLPDHMRG KVKFAPK" misc_feature 222..428 /gene="mRpS25" /note="Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain; Region: L51_S25_CI-B8; smart00916" /db_xref="CDD:197984" polyA_site 654 /gene="mRpS25" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taccaccact ggccaatcag ctgttcggca ttacacaagc agccgcattt tagttgaatt 61 tacattattt ttacgtgatt tacctgaatt aaaaccgcaa aatgccgttc atgaagggcc 121 gcgagcccat ccggcgcacc ctgaagtacc tgaatgcggg caagctggtg ctcaaggaca 181 aggtgcgcat cttcagcgtc aattacaaca catacggcga tcatcacgcg ggagccaggg 241 actttgtgtt ctggaacata ccgcagatcc agttcaagaa ccccgaggtg caggtgctca 301 cgctgaagaa catgacgccc tcgccctttg tgcgctgcta ctttgaagat ggacgggaca 361 tgctcatcga tgtggacggt cgaaaccggg acgagatcat cgagcatttg gtccaggtgg 421 tgggcaagac ccgcgagaca ctggacgcgg aggcgcggct caaggagagc aaggacaacc 481 cggccaactt tggctacgga tgcggccgcc actgcatctg cgagatcccc ggccaggtgg 541 cctgtccggg aaccgttccg ctgcccgatc acatgcgcgg caaggtcaag ttcgcaccca 601 aatagttcgg attctggctg attgtttttt taataaatta attgtaaact acta