Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial ribosomal protein


LOCUS       XM_017139825             654 bp    mRNA    linear   INV 09-DEC-2024
            S25 (mRpS25), mRNA.
ACCESSION   XM_017139825
VERSION     XM_017139825.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139825.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..654
                     /gene="mRpS25"
                     /note="mitochondrial ribosomal protein S25; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108056134"
     CDS             102..605
                     /gene="mRpS25"
                     /codon_start=1
                     /product="small ribosomal subunit protein mS25"
                     /protein_id="XP_016995314.2"
                     /db_xref="GeneID:108056134"
                     /translation="MPFMKGREPIRRTLKYLNAGKLVLKDKVRIFSVNYNTYGDHHAG
                     ARDFVFWNIPQIQFKNPEVQVLTLKNMTPSPFVRCYFEDGRDMLIDVDGRNRDEIIEH
                     LVQVVGKTRETLDAEARLKESKDNPANFGYGCGRHCICEIPGQVACPGTVPLPDHMRG
                     KVKFAPK"
     misc_feature    222..428
                     /gene="mRpS25"
                     /note="Mitochondrial ribosomal protein L51 / S25 / CI-B8
                     domain; Region: L51_S25_CI-B8; smart00916"
                     /db_xref="CDD:197984"
     polyA_site      654
                     /gene="mRpS25"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taccaccact ggccaatcag ctgttcggca ttacacaagc agccgcattt tagttgaatt
       61 tacattattt ttacgtgatt tacctgaatt aaaaccgcaa aatgccgttc atgaagggcc
      121 gcgagcccat ccggcgcacc ctgaagtacc tgaatgcggg caagctggtg ctcaaggaca
      181 aggtgcgcat cttcagcgtc aattacaaca catacggcga tcatcacgcg ggagccaggg
      241 actttgtgtt ctggaacata ccgcagatcc agttcaagaa ccccgaggtg caggtgctca
      301 cgctgaagaa catgacgccc tcgccctttg tgcgctgcta ctttgaagat ggacgggaca
      361 tgctcatcga tgtggacggt cgaaaccggg acgagatcat cgagcatttg gtccaggtgg
      421 tgggcaagac ccgcgagaca ctggacgcgg aggcgcggct caaggagagc aaggacaacc
      481 cggccaactt tggctacgga tgcggccgcc actgcatctg cgagatcccc ggccaggtgg
      541 cctgtccggg aaccgttccg ctgcccgatc acatgcgcgg caaggtcaag ttcgcaccca
      601 aatagttcgg attctggctg attgtttttt taataaatta attgtaaact acta