Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139813 868 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017139813 VERSION XM_017139813.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139813.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..868 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..868 /gene="narya" /note="narya; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056126" CDS 100..774 /gene="narya" /codon_start=1 /product="RING finger protein narya" /protein_id="XP_016995302.2" /db_xref="GeneID:108056126" /translation="MFRVHCNQCQRHQEVDPIVPFHFTTCQHVFCAPCVTKSPPEAKC PVCGRVLQSIAINRDMPIGVANYFEDPARFLQIFRKVSKFQAAQRASDNLGFYHRLQQ FENDKRQLEGYGKMEAHINAKIAAEKKRIGQLRLYLEQHEQEAQKRQRRTSMGLGHRS PADPQLLAFNAAAAASSTSASSTMDEATMQSFFLNSDLGSSSPANPSRQSRKRSHRGD HKDFHL" misc_feature 112..246 /gene="narya" /note="zinc-RING finger domain; Region: zf-RING_5; pfam14634" /db_xref="CDD:434085" misc_feature order(115..117,124..126,175..177,181..183,190..192, 199..201,229..231,238..240) /gene="narya" /note="cross-brace motif; other site" /db_xref="CDD:438111" ORIGIN 1 atcctgtcgc cagagttgcc agacagaagc gcaataaccg atatttaagg agcaaacttt 61 caagttgcaa ttgaaagagt taaaaatcgt taattaataa tgtttcgagt gcattgcaac 121 cagtgccagc gtcaccagga ggtcgatccg atcgtgccct ttcacttcac cacctgccag 181 cacgtatttt gcgcgccctg cgtgaccaaa tccccaccag aagccaagtg cccggtgtgc 241 gggcgggtgc tccagtcgat agcgatcaat cgggacatgc ccatcggcgt ggccaactac 301 ttcgaggatc ccgcccgctt cctgcagatc ttccgcaagg tcagcaagtt ccaggccgcc 361 cagcgggcct cggacaacct gggcttctat caccggctgc agcagttcga gaacgacaag 421 cgccagctgg agggctacgg caagatggag gcgcacatca acgcgaagat cgcagcggag 481 aagaagcgga tcggccagct gcgcctgtac ctggagcagc acgagcagga ggcccagaag 541 aggcagcgac gcaccagcat gggcctgggc catcgatccc cagcggatcc ccagctcctc 601 gccttcaatg ccgccgccgc cgcctcgagc acctcggcca gctccacgat ggacgaggcc 661 accatgcaga gcttcttcct caactcggac ctgggctcct cctcgccagc gaatccgtcc 721 cgtcagtcgc gcaagagatc ccaccgcggc gatcacaagg attttcatct ataactacta 781 tttttcctac tctgctaaac ttaggaagat ccaatgaaaa atgtatataa tatgatatta 841 atataatgat atcatacata tataatat