Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii narya (narya), mRNA.


LOCUS       XM_017139813             868 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139813
VERSION     XM_017139813.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139813.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..868
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..868
                     /gene="narya"
                     /note="narya; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108056126"
     CDS             100..774
                     /gene="narya"
                     /codon_start=1
                     /product="RING finger protein narya"
                     /protein_id="XP_016995302.2"
                     /db_xref="GeneID:108056126"
                     /translation="MFRVHCNQCQRHQEVDPIVPFHFTTCQHVFCAPCVTKSPPEAKC
                     PVCGRVLQSIAINRDMPIGVANYFEDPARFLQIFRKVSKFQAAQRASDNLGFYHRLQQ
                     FENDKRQLEGYGKMEAHINAKIAAEKKRIGQLRLYLEQHEQEAQKRQRRTSMGLGHRS
                     PADPQLLAFNAAAAASSTSASSTMDEATMQSFFLNSDLGSSSPANPSRQSRKRSHRGD
                     HKDFHL"
     misc_feature    112..246
                     /gene="narya"
                     /note="zinc-RING finger domain; Region: zf-RING_5;
                     pfam14634"
                     /db_xref="CDD:434085"
     misc_feature    order(115..117,124..126,175..177,181..183,190..192,
                     199..201,229..231,238..240)
                     /gene="narya"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:438111"
ORIGIN      
        1 atcctgtcgc cagagttgcc agacagaagc gcaataaccg atatttaagg agcaaacttt
       61 caagttgcaa ttgaaagagt taaaaatcgt taattaataa tgtttcgagt gcattgcaac
      121 cagtgccagc gtcaccagga ggtcgatccg atcgtgccct ttcacttcac cacctgccag
      181 cacgtatttt gcgcgccctg cgtgaccaaa tccccaccag aagccaagtg cccggtgtgc
      241 gggcgggtgc tccagtcgat agcgatcaat cgggacatgc ccatcggcgt ggccaactac
      301 ttcgaggatc ccgcccgctt cctgcagatc ttccgcaagg tcagcaagtt ccaggccgcc
      361 cagcgggcct cggacaacct gggcttctat caccggctgc agcagttcga gaacgacaag
      421 cgccagctgg agggctacgg caagatggag gcgcacatca acgcgaagat cgcagcggag
      481 aagaagcgga tcggccagct gcgcctgtac ctggagcagc acgagcagga ggcccagaag
      541 aggcagcgac gcaccagcat gggcctgggc catcgatccc cagcggatcc ccagctcctc
      601 gccttcaatg ccgccgccgc cgcctcgagc acctcggcca gctccacgat ggacgaggcc
      661 accatgcaga gcttcttcct caactcggac ctgggctcct cctcgccagc gaatccgtcc
      721 cgtcagtcgc gcaagagatc ccaccgcggc gatcacaagg attttcatct ataactacta
      781 tttttcctac tctgctaaac ttaggaagat ccaatgaaaa atgtatataa tatgatatta
      841 atataatgat atcatacata tataatat