Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii defective proboscis extension


LOCUS       XM_017139798            1423 bp    mRNA    linear   INV 09-DEC-2024
            response 8 (dpr8), mRNA.
ACCESSION   XM_017139798
VERSION     XM_017139798.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139798.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1423
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1423
                     /gene="dpr8"
                     /note="defective proboscis extension response 8; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:108056117"
     CDS             263..1327
                     /gene="dpr8"
                     /codon_start=1
                     /product="zwei Ig domain protein zig-8"
                     /protein_id="XP_016995287.1"
                     /db_xref="GeneID:108056117"
                     /translation="MSTHWLIFVGISCLLAGCTEGASKRFFTDFLQDLPTPGTGGPTF
                     DTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMH
                     SPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRG
                     STINLTCIVKFAPEPPPTVTWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAIT
                     QDSGLYTCTPSNANPSTVRVHIVDGEHPAAMHTGNNNNNNSTASQPPVLLPLVLLTCG
                     TLMLLQLVACCSALVTAVALVPSADTPPHHPPTSSPSRGQSQQDHQLRGEDIKREGST
                     DLCRRFESFESFGRSAVPGT"
     misc_feature    413..655
                     /gene="dpr8"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    440..454
                     /gene="dpr8"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    479..493
                     /gene="dpr8"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    587..601
                     /gene="dpr8"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    629..646
                     /gene="dpr8"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    719..952
                     /gene="dpr8"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
ORIGIN      
        1 gagcgacggg cgcaaagcct agcatacttt tgggcctgcc ccaataactc aaaacgccgc
       61 ccaaggacga cgagtccgaa cccaaaaacc gaagagcgga aaaagtaaag ccgcagacgg
      121 gcggaaagag cgagaagcga aaagccagcc ccaaggcaac tgcagctgga attaacacaa
      181 aagcttcttt aaagtaaatc aagttcctgg caagcggact taaatatcca aagatagagg
      241 tgctcaagcc atagataaaa atatgtcgac acactggtta atttttgtgg gcatttcgtg
      301 tctgctagca ggctgcacgg agggcgcctc gaagcgcttc ttcaccgact tcctgcagga
      361 cctgccgacg cccggaaccg gaggaccgac cttcgacacg accatcggca ccaacatcac
      421 gggactcgtg ggcaagacgg tgaagctgac ctgccgcgtc aagaatttgg gcaatcgcac
      481 ggtgtcctgg gtgcggcaca gggatataca cctgctgacc gtgggccgct acacgtacac
      541 ctccgaccag cgcttcgagg ccatgcactc gccccacgcc gaggactgga cattgcgtat
      601 acgctacgcg cagcgcaagg actccgggat atacgagtgc cagatatcga ccacgccccc
      661 tattggacac tccgtgtacc tcaacatcgt tgagcccgtc accgacatca tcggcggccc
      721 cgagctgcac atcaaccggg gatccaccat caatctgact tgcattgtga aattcgcacc
      781 ggaaccgccg ccgaccgtca cttggtcgca caaccgcgag atcataaatt tcgattctcc
      841 tcgcggcggc atatcattag tcaccgagaa aggtgtgctg accaccagcc ggctcctcgt
      901 gcagaaggcc atcacccagg actcgggcct ctacacatgc accccctcca acgccaatcc
      961 gagcacagtg cgcgtgcata tcgtcgatgg cgagcatccg gcggccatgc acacgggcaa
     1021 caacaacaac aacaactcga cggcgtccca gccgccggtg ctgctgcccc tggtccttct
     1081 cacctgcggc acgctgatgc tgctgcagct ggtggcctgc tgctccgccc tcgtgaccgc
     1141 cgtcgccctc gtcccctccg cggacacgcc cccccaccat ccaccgacca gcagcccatc
     1201 gagaggacaa agccaacagg atcatcagct tcgaggggag gatattaaaa gggagggatc
     1261 cacagatctg tgccgcagat tcgagagctt cgagagcttc gggaggagcg cggtgcccgg
     1321 gacatagctt ttcggaggat cgggaaccgg aaacggaaac gctgtcgaat tgccaacagg
     1381 aatcgcattt taggctcgca gcccctaagt cctcttgccc ctc