Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139788 804 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017139788 VERSION XM_017139788.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139788.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..804 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..804 /gene="RpS10b" /note="Ribosomal protein S10b; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:108056111" CDS 41..625 /gene="RpS10b" /codon_start=1 /product="small ribosomal subunit protein eS10B" /protein_id="XP_016995277.1" /db_xref="GeneID:108056111" /translation="MCPPLSLTSTFSFLPPRFRGRTRSCNFVFANKSRMFMPKAHRVA IYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKALQSLHSRGLVKEQFAWRHYYWY LTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAAGGPRGPGDASKTGEDRSAY RRAPGGSGVDKKGDVGPGAGEVEFRGGFGRGSRN" misc_feature 149..427 /gene="RpS10b" /note="Plectin/S10 domain; Region: S10_plectin; pfam03501" /db_xref="CDD:427337" polyA_site 804 /gene="RpS10b" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgataggaac acaaccatcg cggcatatcg gctgcgtccg atgtgtccac ctctgtccct 61 aacctcaact ttttcttttc tgccaccacg ttttcgcggg agaacgcgtt cgtgtaactt 121 tgtgtttgca aacaaatcca gaatgtttat gccaaaggcc catcgcgttg cgatctacga 181 gtacctcttc aaggagggcg tgatcgtggc caagaaggac ttccatgccc agaagcaccc 241 ggagctggag tcgatcccca atctgcacgt gatcaaggcc ctccaatcgc tgcattcccg 301 cggccttgtg aaggagcagt tcgcctggcg ccactactac tggtacctca ccaacgaggg 361 catcgaggag ctgcgcagct acctccacct gccccccgag atcgttccct cgaccctgaa 421 gcgccctgcc cgctcggaga cagtgcgtcc ccgtcccgcc gccggcggtc cacgcggacc 481 cggcgacgcc tccaagaccg gcgaggatcg ctccgcctac cgacgtgctc ccggcggcag 541 cggcgtggac aagaagggcg acgttgggcc cggcgccggc gaggtcgagt tccgcggcgg 601 cttcggacgc ggatcccgca actaaacacc acaccatgcg cttcggtttc ttttttttct 661 tatgtataaa aatcaaactc agtaaaggaa atgttgaact gaagatccaa aatccctcaa 721 caacaacata aaaaacgaaa aatgtgtgtg tgttttatat gatatgacga tttgattaaa 781 aagcaaacgc aagtgaaaac cgtg