Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ribosomal protein S10b (RpS10b),


LOCUS       XM_017139788             804 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017139788
VERSION     XM_017139788.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139788.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..804
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..804
                     /gene="RpS10b"
                     /note="Ribosomal protein S10b; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:108056111"
     CDS             41..625
                     /gene="RpS10b"
                     /codon_start=1
                     /product="small ribosomal subunit protein eS10B"
                     /protein_id="XP_016995277.1"
                     /db_xref="GeneID:108056111"
                     /translation="MCPPLSLTSTFSFLPPRFRGRTRSCNFVFANKSRMFMPKAHRVA
                     IYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKALQSLHSRGLVKEQFAWRHYYWY
                     LTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAAGGPRGPGDASKTGEDRSAY
                     RRAPGGSGVDKKGDVGPGAGEVEFRGGFGRGSRN"
     misc_feature    149..427
                     /gene="RpS10b"
                     /note="Plectin/S10 domain; Region: S10_plectin; pfam03501"
                     /db_xref="CDD:427337"
     polyA_site      804
                     /gene="RpS10b"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgataggaac acaaccatcg cggcatatcg gctgcgtccg atgtgtccac ctctgtccct
       61 aacctcaact ttttcttttc tgccaccacg ttttcgcggg agaacgcgtt cgtgtaactt
      121 tgtgtttgca aacaaatcca gaatgtttat gccaaaggcc catcgcgttg cgatctacga
      181 gtacctcttc aaggagggcg tgatcgtggc caagaaggac ttccatgccc agaagcaccc
      241 ggagctggag tcgatcccca atctgcacgt gatcaaggcc ctccaatcgc tgcattcccg
      301 cggccttgtg aaggagcagt tcgcctggcg ccactactac tggtacctca ccaacgaggg
      361 catcgaggag ctgcgcagct acctccacct gccccccgag atcgttccct cgaccctgaa
      421 gcgccctgcc cgctcggaga cagtgcgtcc ccgtcccgcc gccggcggtc cacgcggacc
      481 cggcgacgcc tccaagaccg gcgaggatcg ctccgcctac cgacgtgctc ccggcggcag
      541 cggcgtggac aagaagggcg acgttgggcc cggcgccggc gaggtcgagt tccgcggcgg
      601 cttcggacgc ggatcccgca actaaacacc acaccatgcg cttcggtttc ttttttttct
      661 tatgtataaa aatcaaactc agtaaaggaa atgttgaact gaagatccaa aatccctcaa
      721 caacaacata aaaaacgaaa aatgtgtgtg tgttttatat gatatgacga tttgattaaa
      781 aagcaaacgc aagtgaaaac cgtg