Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139783 886 bp mRNA linear INV 09-DEC-2024 (nmdyn-D6), mRNA. ACCESSION XM_017139783 VERSION XM_017139783.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139783.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..886 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..886 /gene="nmdyn-D6" /note="nucleoside diphosphate kinase 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056107" CDS 216..671 /gene="nmdyn-D6" /codon_start=1 /product="nucleoside diphosphate kinase 6" /protein_id="XP_016995272.2" /db_xref="GeneID:108056107" /translation="MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKEL SERFYAEHQGKFFYHRLTSFMNSGPCYALILQSEACIQKWRSLLGPTKVFRAVYSDPN CIRALYGLSDTRNACHGSDSEASALREIGILFPEFDAAERLKRQEKGQT" misc_feature 219..620 /gene="nmdyn-D6" /note="Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues. NDPk6 has...; Region: NDPk6; cd04414" /db_xref="CDD:239877" misc_feature order(240..242,360..362,384..386,468..470,486..488, 528..530,558..560,567..569,573..578,600..602) /gene="nmdyn-D6" /note="active site" /db_xref="CDD:239877" misc_feature order(252..254,270..278,285..287,318..326) /gene="nmdyn-D6" /note="multimer interface [polypeptide binding]; other site" /db_xref="CDD:239877" ORIGIN 1 agtaaatagt tctaaatatt aaaaaaatag tttgtaataa taatattaat aggaaatatg 61 ctaattattt ttaaaaataa tggcacctgt gcacactccg attgattttc cgaaataccc 121 aataccgata gttccatctc aacggcaatc gaccagccaa tttgtttaca ttttaaaatt 181 attaactacc cataatttac tggaactcca gagatatgga aataaccctg gccctcataa 241 agccgcacgt gctgcggaac acctatgcga tgcaacagat ccgggcgctg atctcccaga 301 acttcacaat tctcgaccag aaggaggttt gcattacgaa agaactctcg gagcgattct 361 acgcggagca ccagggaaaa ttcttctacc accgcctcac cagctttatg aacagtggac 421 cctgctacgc tctgattctt cagtcggagg cctgcatcca gaagtggcgc agtcttctgg 481 gacccaccaa ggtgtttcgg gccgtctata gcgatcccaa ctgcattcga gccctgtacg 541 gcctgtccga tactcgtaat gcctgccatg gatccgacag cgaagcatct gccctccggg 601 aaatcgggat cctgtttccg gagttcgacg ccgccgaaag gctgaaaagg caagaaaaag 661 gacagacgta gcctatatga caccatcttg ggattagttc tacagcattt ctataataag 721 cagttaaatg tcaaaaatta tagagcagtt tcatagaaaa tgcctataag gttgttatat 781 aatttattat tgttatagca ttgttgtctt taataataat aatacataaa ataaatatag 841 attataaaat attaagatca caaaaacact gagaaacagt tgtgtt