Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii chronophin (LOC108056089), mRNA.


LOCUS       XM_017139747            1233 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017139747
VERSION     XM_017139747.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139747.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1233
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1233
                     /gene="LOC108056089"
                     /note="chronophin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108056089"
     CDS             172..1104
                     /gene="LOC108056089"
                     /codon_start=1
                     /product="chronophin"
                     /protein_id="XP_016995236.2"
                     /db_xref="GeneID:108056089"
                     /translation="MAKPQHILQLSEEQRSSFVGSFDRVLSDIDGVLWTMEHNVPRAA
                     DGYAALERSGKQLTFVTNNSVRTVDQCIRRFAKIGMQVQPEQIWHPAQSIVNYLRGIK
                     FEGLIYIIATQPFKAVLREAGFQLLDGPNEFIEESYECLAKNIFDKEPVRAVVIDVDF
                     NLSSPKLLRAHLYLRRPECLLIGGATDRLLPVAKGVNIIGPGAFASILVEASGREGSC
                     ITLGKPGRELGNLIVEHYKIDRPSRVLMVGDMLAQDIGFGRQFGFQTLLVLSGGCTRE
                     QLLAETDPRHIPDYYADSMADVAQLLGETPKAHV"
     misc_feature    241..1062
                     /gene="LOC108056089"
                     /note="haloacid dehalogenase-like superfamily
                     phosphatases, UmpH/NagD family; Region:
                     HAD_Pase_UmpH-like; cd07508"
                     /db_xref="CDD:319811"
     misc_feature    order(253..267,349..360,730..732,838..840,913..921,
                     928..933)
                     /gene="LOC108056089"
                     /note="active site"
                     /db_xref="CDD:319811"
     polyA_site      1233
                     /gene="LOC108056089"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agtgttttcg tggccgtcgt cgttctaacc ggcatttctg aggtgctaat tcagcgcaag
       61 attaggtttc gttttcggtt tcagtttcag cacgagcaat attcagcaaa gtcagttgcc
      121 cgacgaccgt gatcgcgata gcaacacttt cacccagcaa aacggatcac aatggccaaa
      181 ccgcagcaca tcctgcagct gagtgaggag cagcggagca gcttcgtcgg ctccttcgat
      241 cgggtgctca gcgacattga tggcgtcctg tggaccatgg agcacaatgt tccgcgggcc
      301 gccgacggat atgccgcctt ggagcgaagc gggaagcagc tgaccttcgt caccaacaac
      361 agtgttcgta cggtggacca gtgcatccgg cgattcgcca agatcgggat gcaggtgcag
      421 ccggagcaga tctggcatcc ggcccagtcc atcgtcaact atctgcgggg catcaagttc
      481 gagggtctca tctacatcat cgccacccag ccgttcaagg cggtgctccg cgaggcggga
      541 ttccagcttc tggacgggcc caacgagttc atcgaggaga gctacgagtg tctggccaag
      601 aacatcttcg acaaggaacc agtgcgtgcc gtcgtcattg acgtggactt caacctgagc
      661 tccccaaagt tgctgcgggc gcatctgtat ctgcggcgtc cggagtgcct gctgatcgga
      721 ggcgccacgg atcgcctgct gccggtggcc aagggcgtga acatcattgg acccggggcc
      781 tttgcctcca ttctggtgga ggccagtggg agggagggca gctgcatcac actgggcaaa
      841 ccgggtcgcg aactgggcaa tctcattgtg gagcactaca agatcgatcg gcccagtcgg
      901 gtgctcatgg tcggcgatat gctggcccag gatattggct tcgggcggca gttcggtttc
      961 cagacgctgc tcgtcctcag cggcggttgc accagggagc agctcctggc ggagacggat
     1021 ccgcgacaca ttcccgatta ctatgccgac agcatggccg atgtggccca gttgctggga
     1081 gagacgccca aagcgcatgt ttagttgtat atatattata tatatatatg ggtacctggg
     1141 taattgatta tcatcattat tgctatcagc acaataccgt attttattcg ttattatttt
     1201 atctgaaata taattcacac taagcaaaca aaa