Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139747 1233 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017139747 VERSION XM_017139747.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139747.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1233 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1233 /gene="LOC108056089" /note="chronophin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056089" CDS 172..1104 /gene="LOC108056089" /codon_start=1 /product="chronophin" /protein_id="XP_016995236.2" /db_xref="GeneID:108056089" /translation="MAKPQHILQLSEEQRSSFVGSFDRVLSDIDGVLWTMEHNVPRAA DGYAALERSGKQLTFVTNNSVRTVDQCIRRFAKIGMQVQPEQIWHPAQSIVNYLRGIK FEGLIYIIATQPFKAVLREAGFQLLDGPNEFIEESYECLAKNIFDKEPVRAVVIDVDF NLSSPKLLRAHLYLRRPECLLIGGATDRLLPVAKGVNIIGPGAFASILVEASGREGSC ITLGKPGRELGNLIVEHYKIDRPSRVLMVGDMLAQDIGFGRQFGFQTLLVLSGGCTRE QLLAETDPRHIPDYYADSMADVAQLLGETPKAHV" misc_feature 241..1062 /gene="LOC108056089" /note="haloacid dehalogenase-like superfamily phosphatases, UmpH/NagD family; Region: HAD_Pase_UmpH-like; cd07508" /db_xref="CDD:319811" misc_feature order(253..267,349..360,730..732,838..840,913..921, 928..933) /gene="LOC108056089" /note="active site" /db_xref="CDD:319811" polyA_site 1233 /gene="LOC108056089" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agtgttttcg tggccgtcgt cgttctaacc ggcatttctg aggtgctaat tcagcgcaag 61 attaggtttc gttttcggtt tcagtttcag cacgagcaat attcagcaaa gtcagttgcc 121 cgacgaccgt gatcgcgata gcaacacttt cacccagcaa aacggatcac aatggccaaa 181 ccgcagcaca tcctgcagct gagtgaggag cagcggagca gcttcgtcgg ctccttcgat 241 cgggtgctca gcgacattga tggcgtcctg tggaccatgg agcacaatgt tccgcgggcc 301 gccgacggat atgccgcctt ggagcgaagc gggaagcagc tgaccttcgt caccaacaac 361 agtgttcgta cggtggacca gtgcatccgg cgattcgcca agatcgggat gcaggtgcag 421 ccggagcaga tctggcatcc ggcccagtcc atcgtcaact atctgcgggg catcaagttc 481 gagggtctca tctacatcat cgccacccag ccgttcaagg cggtgctccg cgaggcggga 541 ttccagcttc tggacgggcc caacgagttc atcgaggaga gctacgagtg tctggccaag 601 aacatcttcg acaaggaacc agtgcgtgcc gtcgtcattg acgtggactt caacctgagc 661 tccccaaagt tgctgcgggc gcatctgtat ctgcggcgtc cggagtgcct gctgatcgga 721 ggcgccacgg atcgcctgct gccggtggcc aagggcgtga acatcattgg acccggggcc 781 tttgcctcca ttctggtgga ggccagtggg agggagggca gctgcatcac actgggcaaa 841 ccgggtcgcg aactgggcaa tctcattgtg gagcactaca agatcgatcg gcccagtcgg 901 gtgctcatgg tcggcgatat gctggcccag gatattggct tcgggcggca gttcggtttc 961 cagacgctgc tcgtcctcag cggcggttgc accagggagc agctcctggc ggagacggat 1021 ccgcgacaca ttcccgatta ctatgccgac agcatggccg atgtggccca gttgctggga 1081 gagacgccca aagcgcatgt ttagttgtat atatattata tatatatatg ggtacctggg 1141 taattgatta tcatcattat tgctatcagc acaataccgt attttattcg ttattatttt 1201 atctgaaata taattcacac taagcaaaca aaa