Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139739 1172 bp mRNA linear INV 09-DEC-2024 (LOC108056085), mRNA. ACCESSION XM_017139739 VERSION XM_017139739.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139739.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1172 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1172 /gene="LOC108056085" /note="plasminogen receptor (KT); Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056085" CDS 39..503 /gene="LOC108056085" /codon_start=1 /product="plasminogen receptor (KT)" /protein_id="XP_016995228.1" /db_xref="GeneID:108056085" /translation="MGATASCKKSNGSGYPEHDDPSYRKCQELKMERWIQMHYQIKQR EQALAIAQHRELFYWLSGFYLSAVYGCASYYQRVKRVSALAPLLPLTFVVGYYTDWAY GSKLHRIQAEANMIMEHEQELLHWPGGLPTVAGIDEARVETEMEKKMHPHHM" misc_feature 72..449 /gene="LOC108056085" /note="Uncharacterized conserved protein (DUF2368); Region: DUF2368; pfam10166" /db_xref="CDD:431104" ORIGIN 1 attccaacca agcatcccga gattccaatc gcatcgaaat gggtgccacg gcctcgtgta 61 agaaatccaa cggcagtggc tatccggagc acgatgatcc cagctaccga aagtgccagg 121 agctcaagat ggagcgctgg atccagatgc actaccagat caagcagcgg gaacaggcct 181 tggccattgc ccagcaccgc gagctcttct actggctgag cggtttctac ctgagtgccg 241 tctacggctg cgccagctac taccagaggg tcaagagggt ctccgcgctg gctccgctcc 301 tgccgctcac cttcgtggtg ggctactaca cggactgggc ctacggcagc aagctgcacc 361 gcatccaagc ggaggccaac atgatcatgg agcacgagca ggagctgctc cactggccag 421 gcggcctgcc cacggtggcc ggaatcgatg aggcccgcgt ggagacggaa atggaaaaga 481 aaatgcatcc gcaccacatg tagaggcaaa aggctgcccc tctccccgtt agtctgtagg 541 cgggattggg ttctcgtgct caggtcccca ttaaaaatat aaggaaaata ttatgcaacg 601 caatcgatag aatgcaaatc acaatcacac acagtttgag gagtttgaga aagccattag 661 ctagaattga attgttttta agcatcaaca ttcgagaatg ctgaactgta gggaccattt 721 aacaacactc cacaacacaa atgagtttta agcatagaaa aaatctccag aatgctacat 781 tataaatcac aattcctaca cagttctttt catctacagc atttgcattt tgaagaagct 841 gccagagaaa ttatttcgaa acttaagctt gtccctaact ggaacacatc atatcataca 901 gctcctaagg agcgatattt tcccttctaa actcacaaac atatatccat atatcctgca 961 cagaacccca gccagcctac agcgccagat agctcaaata taggcctata tatttatatt 1021 atatatattt atatattcag aactcctctg taacgaccat ttacttagcc gcagtttact 1081 tctaacctaa tctatctatc tgtgtgtgtc tactcacttg ctcgctctgg aaggcgggac 1141 gcgcttcact tttccagcaa ttttttgaga ca