Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii plasminogen receptor (KT)


LOCUS       XM_017139739            1172 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056085), mRNA.
ACCESSION   XM_017139739
VERSION     XM_017139739.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139739.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1172
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1172
                     /gene="LOC108056085"
                     /note="plasminogen receptor (KT); Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056085"
     CDS             39..503
                     /gene="LOC108056085"
                     /codon_start=1
                     /product="plasminogen receptor (KT)"
                     /protein_id="XP_016995228.1"
                     /db_xref="GeneID:108056085"
                     /translation="MGATASCKKSNGSGYPEHDDPSYRKCQELKMERWIQMHYQIKQR
                     EQALAIAQHRELFYWLSGFYLSAVYGCASYYQRVKRVSALAPLLPLTFVVGYYTDWAY
                     GSKLHRIQAEANMIMEHEQELLHWPGGLPTVAGIDEARVETEMEKKMHPHHM"
     misc_feature    72..449
                     /gene="LOC108056085"
                     /note="Uncharacterized conserved protein (DUF2368);
                     Region: DUF2368; pfam10166"
                     /db_xref="CDD:431104"
ORIGIN      
        1 attccaacca agcatcccga gattccaatc gcatcgaaat gggtgccacg gcctcgtgta
       61 agaaatccaa cggcagtggc tatccggagc acgatgatcc cagctaccga aagtgccagg
      121 agctcaagat ggagcgctgg atccagatgc actaccagat caagcagcgg gaacaggcct
      181 tggccattgc ccagcaccgc gagctcttct actggctgag cggtttctac ctgagtgccg
      241 tctacggctg cgccagctac taccagaggg tcaagagggt ctccgcgctg gctccgctcc
      301 tgccgctcac cttcgtggtg ggctactaca cggactgggc ctacggcagc aagctgcacc
      361 gcatccaagc ggaggccaac atgatcatgg agcacgagca ggagctgctc cactggccag
      421 gcggcctgcc cacggtggcc ggaatcgatg aggcccgcgt ggagacggaa atggaaaaga
      481 aaatgcatcc gcaccacatg tagaggcaaa aggctgcccc tctccccgtt agtctgtagg
      541 cgggattggg ttctcgtgct caggtcccca ttaaaaatat aaggaaaata ttatgcaacg
      601 caatcgatag aatgcaaatc acaatcacac acagtttgag gagtttgaga aagccattag
      661 ctagaattga attgttttta agcatcaaca ttcgagaatg ctgaactgta gggaccattt
      721 aacaacactc cacaacacaa atgagtttta agcatagaaa aaatctccag aatgctacat
      781 tataaatcac aattcctaca cagttctttt catctacagc atttgcattt tgaagaagct
      841 gccagagaaa ttatttcgaa acttaagctt gtccctaact ggaacacatc atatcataca
      901 gctcctaagg agcgatattt tcccttctaa actcacaaac atatatccat atatcctgca
      961 cagaacccca gccagcctac agcgccagat agctcaaata taggcctata tatttatatt
     1021 atatatattt atatattcag aactcctctg taacgaccat ttacttagcc gcagtttact
     1081 tctaacctaa tctatctatc tgtgtgtgtc tactcacttg ctcgctctgg aaggcgggac
     1141 gcgcttcact tttccagcaa ttttttgaga ca