Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ribosomal RNA processing 47


LOCUS       XM_017139709             562 bp    mRNA    linear   INV 09-DEC-2024
            (Rrp47), mRNA.
ACCESSION   XM_017139709
VERSION     XM_017139709.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139709.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..562
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..562
                     /gene="Rrp47"
                     /note="Ribosomal RNA processing 47; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108056069"
     CDS             61..540
                     /gene="Rrp47"
                     /codon_start=1
                     /product="nuclear nucleic acid-binding protein C1D"
                     /protein_id="XP_016995198.2"
                     /db_xref="GeneID:108056069"
                     /translation="MSQGNNTADKGLPCDLYLDKTLQDDANMQGILKTFYGSIEVLEA
                     DLEKALALQAGRTLTANEQIKLDSYMAYLNSTLFWIHLKLQGVDVAKHGVMHDLGRAK
                     ELLARDKEINASLAAPRLDLQAAKRFIAAGTHTRFVDMDGVMVTEKQYNKSLQATEK"
     misc_feature    172..381
                     /gene="Rrp47"
                     /note="Sas10/Utp3/C1D family; Region: Sas10_Utp3;
                     pfam04000"
                     /db_xref="CDD:461123"
     polyA_site      562
                     /gene="Rrp47"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcatacttca aggctagttg taaatagacg cacacgattt caattcattt tgtagaaaat
       61 atgtctcaag gaaacaatac tgctgacaag gggctgccct gtgaccttta cctggacaaa
      121 acgctgcagg atgatgcgaa tatgcaagga atactgaaga ccttctacgg cagcattgag
      181 gttctggaag cggacctgga aaaggcactg gcgctccaag caggacgcac attgaccgca
      241 aacgagcaaa tcaaactgga tagctacatg gcctacctga atagcacgct gttttggata
      301 cacctgaaac tgcagggcgt agatgtcgca aagcacggtg taatgcacga tttggggcgc
      361 gccaaagaac tacttgcccg cgataaggaa ataaacgctt ctctggcggc cccgagattg
      421 gatttgcagg ctgccaagcg atttattgcc gccggaacgc acacgcgttt cgtagacatg
      481 gacggagtta tggtcaccga aaaacagtat aataaaagtc tgcaagcaac tgagaaataa
      541 aaaagaaacc aacatctaag aa