Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139709 562 bp mRNA linear INV 09-DEC-2024 (Rrp47), mRNA. ACCESSION XM_017139709 VERSION XM_017139709.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139709.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..562 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..562 /gene="Rrp47" /note="Ribosomal RNA processing 47; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056069" CDS 61..540 /gene="Rrp47" /codon_start=1 /product="nuclear nucleic acid-binding protein C1D" /protein_id="XP_016995198.2" /db_xref="GeneID:108056069" /translation="MSQGNNTADKGLPCDLYLDKTLQDDANMQGILKTFYGSIEVLEA DLEKALALQAGRTLTANEQIKLDSYMAYLNSTLFWIHLKLQGVDVAKHGVMHDLGRAK ELLARDKEINASLAAPRLDLQAAKRFIAAGTHTRFVDMDGVMVTEKQYNKSLQATEK" misc_feature 172..381 /gene="Rrp47" /note="Sas10/Utp3/C1D family; Region: Sas10_Utp3; pfam04000" /db_xref="CDD:461123" polyA_site 562 /gene="Rrp47" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcatacttca aggctagttg taaatagacg cacacgattt caattcattt tgtagaaaat 61 atgtctcaag gaaacaatac tgctgacaag gggctgccct gtgaccttta cctggacaaa 121 acgctgcagg atgatgcgaa tatgcaagga atactgaaga ccttctacgg cagcattgag 181 gttctggaag cggacctgga aaaggcactg gcgctccaag caggacgcac attgaccgca 241 aacgagcaaa tcaaactgga tagctacatg gcctacctga atagcacgct gttttggata 301 cacctgaaac tgcagggcgt agatgtcgca aagcacggtg taatgcacga tttggggcgc 361 gccaaagaac tacttgcccg cgataaggaa ataaacgctt ctctggcggc cccgagattg 421 gatttgcagg ctgccaagcg atttattgcc gccggaacgc acacgcgttt cgtagacatg 481 gacggagtta tggtcaccga aaaacagtat aataaaagtc tgcaagcaac tgagaaataa 541 aaaagaaacc aacatctaag aa