PREDICTED: Drosophila takahashii protein FAM136A (LOC108056065),

LOCUS       XM_017139692             568 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017139692
VERSION     XM_017139692.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139692.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..568
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..568
                     /gene="LOC108056065"
                     /note="protein FAM136A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108056065"
     CDS             62..481
                     /gene="LOC108056065"
                     /codon_start=1
                     /product="protein FAM136A"
                     /protein_id="XP_016995181.3"
                     /db_xref="GeneID:108056065"
                     /translation="MILKNQKKMDCDQPSLEEQRERVDNVIVTAMEDLDREYLRKLQI
                     EMHACATACCADADANAEAVERCVDRCQLPLTRARCFVQQGISEFENRLEKCIQQCRG
                     SADCHLEERCSSNCVDSHVGLLPEMLRAMRDTLEKGV"
     misc_feature    116..448
                     /gene="LOC108056065"
                     /note="Eukaryotic protein of unknown function (DUF842);
                     Region: DUF842; pfam05811"
                     /db_xref="CDD:461747"
ORIGIN      
        1 ctcaagcaga aacaataaat ttttcaaaca aaaccaaaat ataccatcca tactacatta
       61 tatgatattg aaaaaccaaa agaaaatgga ctgcgatcaa ccgagtttgg aggagcagcg
      121 cgagcgtgtg gataatgtga tcgtgaccgc catggaggat ctggatcggg aatatctgcg
      181 gaagttgcag atcgagatgc acgcctgtgc gaccgcctgc tgtgcggatg cggatgcgaa
      241 tgcggaggcg gtggagcggt gcgtggaccg ctgccagctg cctttgaccc gagcccgctg
      301 ctttgtgcag cagggcatct ccgagttcga gaatcgcctg gagaagtgca tccagcagtg
      361 ccgtggatcc gccgattgcc atctggagga aaggtgctcc agcaattgcg tggacagtca
      421 tgtgggactg ctgcccgaaa tgctcagggc catgcgagat accctggaaa agggtgttta
      481 atagggtgtt cttttccaac aaacatcaga acataaaaat gttcctttat ttttattaaa
      541 ccattattgg catattaaaa attatatg