Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139689 591 bp mRNA linear INV 09-DEC-2024 (LOC108056064), mRNA. ACCESSION XM_017139689 VERSION XM_017139689.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139689.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..591 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..591 /gene="LOC108056064" /note="uncharacterized LOC108056064; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056064" CDS 1..426 /gene="LOC108056064" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016995178.2" /db_xref="GeneID:108056064" /translation="MHLQVLGLLLCLTAFGSSAFDRESLSKRSYDLINEKRSVQLKEN PVFMDRLLFSQTSFNDLMRYSRASLTQPFTPFEKRVIRLLRKLGLLKSEAEKFLDELE NDKELLEKLKKLLDEVDREHESDDFLDDFYELFFSKNKQ" polyA_site 591 /gene="LOC108056064" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgcacttgc aagtcttggg attgctgctt tgtttaacag ccttcggatc ttcggccttc 61 gatcgtgagt cgctcagtaa gcgatcctat gatcttataa atgagaagcg ttccgtacag 121 ctgaaagaga atcctgtatt tatggatcgc ctgctgtttt cccagacgtc cttcaacgat 181 ctaatgagat attcccgagc cagtttaact caacctttta caccatttga aaagcgtgtg 241 atacgcttat tacgtaaatt gggattattg aaaagcgaag ctgaaaaatt tctggatgaa 301 ctggaaaacg ataaggaact attagaaaaa ttgaaaaagt tactcgatga ggtggacagg 361 gaacatgagt ccgatgactt ccttgatgac ttttacgaac tatttttttc gaaaaataag 421 caatagattt tgtgttatta ttaagaaacc gtcttaaaca tatgtaaata tattttccta 481 attcctttaa tttagatcta aataataatt ttgcctaata tgatgtcaaa tatgcatatc 541 gataacaaga ccgattatac cgataacatg ttaatgaata agccctgaga a