Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139688 622 bp mRNA linear INV 09-DEC-2024 (LOC108056063), transcript variant X3, mRNA. ACCESSION XM_017139688 VERSION XM_017139688.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139688.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..622 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..622 /gene="LOC108056063" /note="uncharacterized LOC108056063; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056063" CDS 1..594 /gene="LOC108056063" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_016995177.2" /db_xref="GeneID:108056063" /translation="MGFYRNLLGFITLFGFLQLTKQHCYMMKLVGAKSWDTPNYGLKI NMFEKNNSMSSVTTVRQDVAIPLWHLVLLQHPRKRSSGASASRAELPRTLYNSTTKTC DFWKYIRHVSAWNNVAKLMLSKGASNMSLACPLKQGVYVMNRIQVPPETAILKFMYHP NTLYTLEGTVFALSPKDKVTKRALCHYEINATIYKSC" misc_feature 271..555 /gene="LOC108056063" /note="Protein of unknown function (DUF1091); Region: DUF1091; cl14905" /db_xref="CDD:472716" ORIGIN 1 atgggattct ataggaactt gttgggtttt ataactctgt ttggctttct gcaattaacc 61 aaacagcact gctacatgat gaagctggtg ggcgccaagt cctgggatac gcccaactac 121 gggctgaaga tcaacatgtt cgagaagaac aactcgatgt cctcggtgac gacggtgcgt 181 caggatgtgg ccattccgtt gtggcacctc gtccttttgc agcatccgcg aaaaaggagt 241 tccggcgcct cggcgagtcg agcggaattg ccgcgaaccc tctacaattc aacgactaag 301 acctgcgact tctggaaata cattcgccac gtctccgcct ggaacaacgt ggccaagctg 361 atgctctcga agggcgccag caatatgagc ctcgcctgtc ccttgaaaca gggcgtatac 421 gtgatgaatc gcatccaagt gccgccggaa acggcgatcc tgaagttcat gtaccacccg 481 aatacactgt acaccctcga gggcaccgtc ttcgccctga gtcccaagga caaggtcacc 541 aagagggctc tgtgccacta tgagatcaat gccactatct ataagtcttg ctaaaagtct 601 cccaaattaa ccacaaagtt at