Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017139688             622 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056063), transcript variant X3, mRNA.
ACCESSION   XM_017139688
VERSION     XM_017139688.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139688.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..622
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..622
                     /gene="LOC108056063"
                     /note="uncharacterized LOC108056063; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108056063"
     CDS             1..594
                     /gene="LOC108056063"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_016995177.2"
                     /db_xref="GeneID:108056063"
                     /translation="MGFYRNLLGFITLFGFLQLTKQHCYMMKLVGAKSWDTPNYGLKI
                     NMFEKNNSMSSVTTVRQDVAIPLWHLVLLQHPRKRSSGASASRAELPRTLYNSTTKTC
                     DFWKYIRHVSAWNNVAKLMLSKGASNMSLACPLKQGVYVMNRIQVPPETAILKFMYHP
                     NTLYTLEGTVFALSPKDKVTKRALCHYEINATIYKSC"
     misc_feature    271..555
                     /gene="LOC108056063"
                     /note="Protein of unknown function (DUF1091); Region:
                     DUF1091; cl14905"
                     /db_xref="CDD:472716"
ORIGIN      
        1 atgggattct ataggaactt gttgggtttt ataactctgt ttggctttct gcaattaacc
       61 aaacagcact gctacatgat gaagctggtg ggcgccaagt cctgggatac gcccaactac
      121 gggctgaaga tcaacatgtt cgagaagaac aactcgatgt cctcggtgac gacggtgcgt
      181 caggatgtgg ccattccgtt gtggcacctc gtccttttgc agcatccgcg aaaaaggagt
      241 tccggcgcct cggcgagtcg agcggaattg ccgcgaaccc tctacaattc aacgactaag
      301 acctgcgact tctggaaata cattcgccac gtctccgcct ggaacaacgt ggccaagctg
      361 atgctctcga agggcgccag caatatgagc ctcgcctgtc ccttgaaaca gggcgtatac
      421 gtgatgaatc gcatccaagt gccgccggaa acggcgatcc tgaagttcat gtaccacccg
      481 aatacactgt acaccctcga gggcaccgtc ttcgccctga gtcccaagga caaggtcacc
      541 aagagggctc tgtgccacta tgagatcaat gccactatct ataagtcttg ctaaaagtct
      601 cccaaattaa ccacaaagtt at