Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii transmembrane protein 167A-like


LOCUS       XM_017139674             463 bp    mRNA    linear   INV 09-DEC-2024
            protein ksh (ksh), mRNA.
ACCESSION   XM_017139674
VERSION     XM_017139674.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139674.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..463
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..463
                     /gene="ksh"
                     /note="transmembrane protein 167A-like protein ksh;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:108056059"
     CDS             152..370
                     /gene="ksh"
                     /codon_start=1
                     /product="protein kish"
                     /protein_id="XP_016995163.1"
                     /db_xref="GeneID:108056059"
                     /translation="MSALFNFQSLLSVILLLICTCAYLRSLFPSIIDRNKTGFLGTFW
                     KLARIGERKSPWVGAACLIMAFTVLFWS"
     misc_feature    <206..283
                     /gene="ksh"
                     /note="Protein of unknown function (DUF1242); Region:
                     DUF1242; pfam06842"
                     /db_xref="CDD:462019"
ORIGIN      
        1 catctcttat agcttccaaa tttccaataa gcaaggaacc agttatcgaa ccagttgttg
       61 tctaggcccc gattttggca tagcagctgg gcacgtcact agtttaccgt tttgttattg
      121 ttgcactgcc gacgaatcga atacgaaaat catgagcgcc ctgttcaact tccagagcct
      181 gctgtcggtc atcctgctgc tgatctgcac ctgtgcctac ctgcgctccc tcttccccag
      241 catcatagac cgcaacaaga cgggtttcct gggcaccttc tggaagctgg cgaggatcgg
      301 ggaacgcaag tcgccctggg tgggagccgc ctgcctgatc atggccttca ccgttctctt
      361 ctggagctga agatcgtaga ttaaagaaat atcccatatc ctattccaaa ctctcttaag
      421 aactgtaaat acaagctgcg ttgtgcagca ctggcccgga ctt