Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial ribosomal protein


LOCUS       XM_017139672             583 bp    mRNA    linear   INV 09-DEC-2024
            S14 (mRpS14), mRNA.
ACCESSION   XM_017139672
VERSION     XM_017139672.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139672.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..583
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..583
                     /gene="mRpS14"
                     /note="mitochondrial ribosomal protein S14; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056057"
     CDS             144..530
                     /gene="mRpS14"
                     /codon_start=1
                     /product="small ribosomal subunit protein uS14m"
                     /protein_id="XP_016995161.1"
                     /db_xref="GeneID:108056057"
                     /translation="MNSLARIGGFVCQSVQIAGCGLQQVRTKYADWKMIRDVKRRKCV
                     GEHAVERLRVNSLRKNDILPPELRELADAQIAAFPRDSSLVRVRERCALTSRPRGVVH
                     KYRLSRIVWRHLADYNKLSGVQRAMW"
     misc_feature    243..527
                     /gene="mRpS14"
                     /note="30S ribosomal protein S14; Reviewed; Region: rpsN;
                     cl00355"
                     /db_xref="CDD:469739"
     polyA_site      583
                     /gene="mRpS14"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aattgggttt aaaaatattt agccacacac ttagccattc acagctggga caatcgtttg
       61 tattgatagc cgtgtcacga tagttgtcta tcgggggcag aggaagaaga agaagatcaa
      121 ggcaaccggc agcaattacc aacatgaatt ctctggccag gatcgggggc tttgtatgcc
      181 agtcggtgca aatagccggc tgtggactcc agcaggtgcg caccaagtac gccgactgga
      241 agatgatccg cgatgtcaag cggcgcaagt gcgtcgggga gcacgccgtg gagcggctgc
      301 gggtcaattc gctgcgcaag aacgacatcc tgccgccgga actgcgcgag ctggccgacg
      361 cccagattgc agcctttccc agggattcat cactcgtccg ggtgcgggaa cgctgtgcgc
      421 ttacgtcacg gccgcgcgga gtggtccaca agtaccggct gagccgcatc gtttggcgcc
      481 acctcgccga ctacaacaag ctgtccgggg tgcagcgcgc catgtggtag gggctccttt
      541 tctgttacaa atctaggcaa aataaaccat gttagtagtc caa