Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139672 583 bp mRNA linear INV 09-DEC-2024 S14 (mRpS14), mRNA. ACCESSION XM_017139672 VERSION XM_017139672.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139672.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..583 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..583 /gene="mRpS14" /note="mitochondrial ribosomal protein S14; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056057" CDS 144..530 /gene="mRpS14" /codon_start=1 /product="small ribosomal subunit protein uS14m" /protein_id="XP_016995161.1" /db_xref="GeneID:108056057" /translation="MNSLARIGGFVCQSVQIAGCGLQQVRTKYADWKMIRDVKRRKCV GEHAVERLRVNSLRKNDILPPELRELADAQIAAFPRDSSLVRVRERCALTSRPRGVVH KYRLSRIVWRHLADYNKLSGVQRAMW" misc_feature 243..527 /gene="mRpS14" /note="30S ribosomal protein S14; Reviewed; Region: rpsN; cl00355" /db_xref="CDD:469739" polyA_site 583 /gene="mRpS14" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aattgggttt aaaaatattt agccacacac ttagccattc acagctggga caatcgtttg 61 tattgatagc cgtgtcacga tagttgtcta tcgggggcag aggaagaaga agaagatcaa 121 ggcaaccggc agcaattacc aacatgaatt ctctggccag gatcgggggc tttgtatgcc 181 agtcggtgca aatagccggc tgtggactcc agcaggtgcg caccaagtac gccgactgga 241 agatgatccg cgatgtcaag cggcgcaagt gcgtcgggga gcacgccgtg gagcggctgc 301 gggtcaattc gctgcgcaag aacgacatcc tgccgccgga actgcgcgag ctggccgacg 361 cccagattgc agcctttccc agggattcat cactcgtccg ggtgcgggaa cgctgtgcgc 421 ttacgtcacg gccgcgcgga gtggtccaca agtaccggct gagccgcatc gtttggcgcc 481 acctcgccga ctacaacaag ctgtccgggg tgcagcgcgc catgtggtag gggctccttt 541 tctgttacaa atctaggcaa aataaaccat gttagtagtc caa