Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH:ubiquinone oxidoreductase


LOCUS       XM_017139671             834 bp    mRNA    linear   INV 09-DEC-2024
            subunit 18 (ND-18), mRNA.
ACCESSION   XM_017139671
VERSION     XM_017139671.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139671.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..834
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..834
                     /gene="ND-18"
                     /note="NADH:ubiquinone oxidoreductase subunit 18; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056055"
     CDS             136..696
                     /gene="ND-18"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] iron-sulfur
                     protein 4, mitochondrial"
                     /protein_id="XP_016995160.2"
                     /db_xref="GeneID:108056055"
                     /translation="MSALRQVMCRGSASLQLYQANKLVAARWASASSTSPDGGPLDPK
                     LALARPEELEQRNKLSGKISVPTAVNLGPITGVPEEHLKERRVRIHIPPKNAMQSGTD
                     NINTWQIEFDNRERWENPLMGWASTGDPLSNMNVQFGSQEEAINYCERNGWRWYVDGG
                     EKPKKERVKNYGINFSWNKRTRVSTK"
     misc_feature    391..669
                     /gene="ND-18"
                     /note="NADH dehydrogenase ubiquinone Fe-S protein 4;
                     Region: NDUS4; pfam04800"
                     /db_xref="CDD:461433"
     polyA_site      834
                     /gene="ND-18"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agtcacccct gccaccgaac agctgttttt tgccccactg cccaaaagcg cttgtgttcc
       61 aaattttacg taattcgtat attttgtatt ttaaagccga atattgcaag cagtcgccgc
      121 agccgcctag cgaaaatgtc ggccctccgc caagtgatgt gcagaggcag cgcctcgctg
      181 cagctttatc aggccaacaa actggtggcc gcccgctggg cttcggcctc ctcaacctcg
      241 ccagacggcg gcccgctgga ccctaagttg gccttggccc gccccgagga gctggagcag
      301 cgcaacaagc tgagcggcaa gatctccgtg cccacggccg tcaatctggg ccccataacc
      361 ggtgtgcccg aggagcacct gaaggagaga cgcgtccgca tccacatacc gcccaagaac
      421 gccatgcaga gcggcacgga caacatcaat acctggcaga tcgagttcga caaccgcgaa
      481 cgctgggaga atcccctcat gggctgggca tccactggcg atccgctgtc caacatgaac
      541 gtgcagttcg gctcccagga ggaggccatc aattactgcg aacgcaatgg ctggcgctgg
      601 tatgtcgatg gcggcgagaa gcccaagaag gagcgcgtca agaactacgg catcaacttt
      661 tcctggaaca agcgcacgcg cgtctccacc aagtagaaaa ttaccacttt tttttttgct
      721 gttctccttg ctttgttcac ttatctaaat actgaataac cgaattaaat agtcgagtgc
      781 agcaggctgg gaagcaggct aatgacctcc agttgcggtt tgactaggaa ttaa