Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139671 834 bp mRNA linear INV 09-DEC-2024 subunit 18 (ND-18), mRNA. ACCESSION XM_017139671 VERSION XM_017139671.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139671.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..834 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..834 /gene="ND-18" /note="NADH:ubiquinone oxidoreductase subunit 18; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056055" CDS 136..696 /gene="ND-18" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial" /protein_id="XP_016995160.2" /db_xref="GeneID:108056055" /translation="MSALRQVMCRGSASLQLYQANKLVAARWASASSTSPDGGPLDPK LALARPEELEQRNKLSGKISVPTAVNLGPITGVPEEHLKERRVRIHIPPKNAMQSGTD NINTWQIEFDNRERWENPLMGWASTGDPLSNMNVQFGSQEEAINYCERNGWRWYVDGG EKPKKERVKNYGINFSWNKRTRVSTK" misc_feature 391..669 /gene="ND-18" /note="NADH dehydrogenase ubiquinone Fe-S protein 4; Region: NDUS4; pfam04800" /db_xref="CDD:461433" polyA_site 834 /gene="ND-18" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agtcacccct gccaccgaac agctgttttt tgccccactg cccaaaagcg cttgtgttcc 61 aaattttacg taattcgtat attttgtatt ttaaagccga atattgcaag cagtcgccgc 121 agccgcctag cgaaaatgtc ggccctccgc caagtgatgt gcagaggcag cgcctcgctg 181 cagctttatc aggccaacaa actggtggcc gcccgctggg cttcggcctc ctcaacctcg 241 ccagacggcg gcccgctgga ccctaagttg gccttggccc gccccgagga gctggagcag 301 cgcaacaagc tgagcggcaa gatctccgtg cccacggccg tcaatctggg ccccataacc 361 ggtgtgcccg aggagcacct gaaggagaga cgcgtccgca tccacatacc gcccaagaac 421 gccatgcaga gcggcacgga caacatcaat acctggcaga tcgagttcga caaccgcgaa 481 cgctgggaga atcccctcat gggctgggca tccactggcg atccgctgtc caacatgaac 541 gtgcagttcg gctcccagga ggaggccatc aattactgcg aacgcaatgg ctggcgctgg 601 tatgtcgatg gcggcgagaa gcccaagaag gagcgcgtca agaactacgg catcaacttt 661 tcctggaaca agcgcacgcg cgtctccacc aagtagaaaa ttaccacttt tttttttgct 721 gttctccttg ctttgttcac ttatctaaat actgaataac cgaattaaat agtcgagtgc 781 agcaggctgg gaagcaggct aatgacctcc agttgcggtt tgactaggaa ttaa