Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139670 1015 bp mRNA linear INV 09-DEC-2024 regulator of actin dynamics (LOC108056054), mRNA. ACCESSION XM_017139670 VERSION XM_017139670.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139670.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1015 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1015 /gene="LOC108056054" /note="capping protein inhibiting regulator of actin dynamics; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056054" CDS 53..835 /gene="LOC108056054" /codon_start=1 /product="capping protein inhibiting regulator of actin dynamics" /protein_id="XP_016995159.2" /db_xref="GeneID:108056054" /translation="MSGEDREQLRGFVTASRRRLGDLLERLGWSEGATSNHMPEEKPE ILEELPLPASCCTNPAFTLQLDEATLKQVIGKDAGCIQSFKDLQVALSQQQRLLIYEH VQQHTAKHPEFQDNAAFAQLVGETKREQKKRRRHRISKPTLNEELHQLVKLQMEALQR QWQQEREHKKQEKDHREHREQEEEHRKQEKEHREHKKQEKTHKKQEEEHREHRKHEKE HRDRHRHSASSRKRSRSPEKHRHGHRRREERHRNHHPYKSDH" polyA_site 1015 /gene="LOC108056054" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcccggactt cacaacactg ttttccattg ttttggcgtt gcttgtgcta gaatgtctgg 61 agaagatcgg gagcagctgc gtggctttgt gaccgccagc aggaggcgcc taggagatct 121 cctcgagcgt ttaggttgga gtgagggggc caccagtaac cacatgccag aggagaagcc 181 agaaatcttg gaggaactgc cattgccggc ctcctgctgc acaaatccag catttacact 241 ccaattggat gaggctacct taaagcaggt tattggaaag gatgcagggt gcattcagtc 301 attcaaagac ctgcaggtgg cactgagtca gcaacagcga ctcctcatct acgagcacgt 361 gcagcagcac acggcgaagc acccggagtt ccaggacaac gccgcctttg cccagctggt 421 gggcgagacg aagcgggagc agaagaagcg gcgtcgccat cggataagca agcccacgct 481 caacgaggag ctgcaccagt tggtcaaact gcagatggag gcgctgcaga ggcagtggca 541 gcaggagagg gagcacaaga aacaggagaa ggatcatagg gagcacaggg agcaggagga 601 ggagcacaga aagcaggaga aggagcacag ggagcacaag aagcaggaga agacacacaa 661 gaagcaggag gaggagcaca gggagcacag aaagcatgag aaggagcaca gggatcgcca 721 caggcactca gcaagcagcc ggaagaggag ccgcagcccg gagaagcatc gccatggtca 781 caggcggcgg gaagagcgcc acaggaacca ccatccatac aaatccgatc attaattcct 841 agtcaaaccg caactggagg tcattagcct gcttcccagc ctgctgcact cgactattta 901 attcggttat tcagtattta gataagtgaa caaagcaagg agaacagcaa aaaaaaaagt 961 ggtaattttc tacttggtgg agacgcgcgt gcgcttgttc caggaaaagt tgatg