Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139658 728 bp mRNA linear INV 09-DEC-2024 (LOC108056046), mRNA. ACCESSION XM_017139658 VERSION XM_017139658.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139658.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..728 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..728 /gene="LOC108056046" /note="deubiquitinase DESI2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056046" CDS 122..679 /gene="LOC108056046" /codon_start=1 /product="deubiquitinase DESI2" /protein_id="XP_016995147.2" /db_xref="GeneID:108056046" /translation="MFFNRLRSLPCLGGGGGGGGGAGGRSCDEILPKEPVVLNVYDLV DTNDYTMALGVGFFHSGVQLYGREYGFGGHEFAMSGIFEIRPCNGQAELGEHFRFRES ILLGYTHLSSTEVERIVQQLGAQFQGNSYHLTSKNCNHFSNSLARIVCGRKIPGWVNR LAYLITCVPFLERCMIPSPSYHQHH" misc_feature 221..652 /gene="LOC108056046" /note="PPPDE putative peptidase domain; Region: Peptidase_C97; pfam05903" /db_xref="CDD:461775" polyA_site 728 /gene="LOC108056046" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagctgggat tgccagtcgg tttctcctgt caaccgtttg tgtatcctat ggttgatgta 61 aataaattca aagtttgtac gaatctgctg gcgatcgtgg tgacaagtga gatatcaagg 121 catgttcttc aaccgcctga ggagtttacc ctgcctggga ggcggaggcg gaggaggagg 181 aggcgccggc ggcaggagct gcgatgagat cctgcccaag gagccggtgg tgctcaacgt 241 gtacgatctg gtggacacca acgactatac catggcgctg ggcgtgggct tcttccactc 301 gggcgtccag ctgtatggcc gcgagtacgg attcggcggc cacgagttcg ccatgtcggg 361 catcttcgag atccggccct gcaacgggca ggcggagctg ggcgagcact tccggttccg 421 ggagagcatc ctgctgggtt acacacatct cagcagcacc gaggtggagc gcatcgtcca 481 gcagctgggg gcgcagttcc aggggaatag ctaccacctg accagcaaga actgcaacca 541 cttctccaac agcctggccc gcatcgtctg cggccggaag atcccgggat gggtgaaccg 601 actggcctac ctgatcacct gcgtcccctt cctcgagcgc tgcatgatcc ccagtccgtc 661 gtatcaccag catcattaat tttcaattaa ctaaaggcca attaaatctt tatatttccc 721 taaaataa