Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii deubiquitinase DESI2


LOCUS       XM_017139658             728 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056046), mRNA.
ACCESSION   XM_017139658
VERSION     XM_017139658.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139658.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..728
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..728
                     /gene="LOC108056046"
                     /note="deubiquitinase DESI2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056046"
     CDS             122..679
                     /gene="LOC108056046"
                     /codon_start=1
                     /product="deubiquitinase DESI2"
                     /protein_id="XP_016995147.2"
                     /db_xref="GeneID:108056046"
                     /translation="MFFNRLRSLPCLGGGGGGGGGAGGRSCDEILPKEPVVLNVYDLV
                     DTNDYTMALGVGFFHSGVQLYGREYGFGGHEFAMSGIFEIRPCNGQAELGEHFRFRES
                     ILLGYTHLSSTEVERIVQQLGAQFQGNSYHLTSKNCNHFSNSLARIVCGRKIPGWVNR
                     LAYLITCVPFLERCMIPSPSYHQHH"
     misc_feature    221..652
                     /gene="LOC108056046"
                     /note="PPPDE putative peptidase domain; Region:
                     Peptidase_C97; pfam05903"
                     /db_xref="CDD:461775"
     polyA_site      728
                     /gene="LOC108056046"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagctgggat tgccagtcgg tttctcctgt caaccgtttg tgtatcctat ggttgatgta
       61 aataaattca aagtttgtac gaatctgctg gcgatcgtgg tgacaagtga gatatcaagg
      121 catgttcttc aaccgcctga ggagtttacc ctgcctggga ggcggaggcg gaggaggagg
      181 aggcgccggc ggcaggagct gcgatgagat cctgcccaag gagccggtgg tgctcaacgt
      241 gtacgatctg gtggacacca acgactatac catggcgctg ggcgtgggct tcttccactc
      301 gggcgtccag ctgtatggcc gcgagtacgg attcggcggc cacgagttcg ccatgtcggg
      361 catcttcgag atccggccct gcaacgggca ggcggagctg ggcgagcact tccggttccg
      421 ggagagcatc ctgctgggtt acacacatct cagcagcacc gaggtggagc gcatcgtcca
      481 gcagctgggg gcgcagttcc aggggaatag ctaccacctg accagcaaga actgcaacca
      541 cttctccaac agcctggccc gcatcgtctg cggccggaag atcccgggat gggtgaaccg
      601 actggcctac ctgatcacct gcgtcccctt cctcgagcgc tgcatgatcc ccagtccgtc
      661 gtatcaccag catcattaat tttcaattaa ctaaaggcca attaaatctt tatatttccc
      721 taaaataa