Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017139656             838 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056045), mRNA.
ACCESSION   XM_017139656
VERSION     XM_017139656.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139656.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..838
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..838
                     /gene="LOC108056045"
                     /note="uncharacterized LOC108056045; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108056045"
     CDS             119..601
                     /gene="LOC108056045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016995145.2"
                     /db_xref="GeneID:108056045"
                     /translation="MVKIRPNSVKMPQHAHGIGNRRANQNVLSRLPKGVVHSYIKTEH
                     YLIRRTIQGCRRIIIQRDWPLVRRRIHFQRAGAMGNMIPSVMDSGVLLGRWNRRAKAS
                     FHMDWIRRHELVEVPEDPDEVEYLEESWESEEEPESSSTSGYSSRPRSEEIPSEMDVD
                     "
     polyA_site      838
                     /gene="LOC108056045"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaataatcag tacaactata caaactcaac tgaaaacacc acacaccaca cagtattacc
       61 tagaatattt ttttgtcgtg ttttttttag tcaacgaaga ttttcgattt cgataaaaat
      121 ggtcaaaatt cggcccaatt cggtcaagat gccccaacat gctcatggaa taggcaacag
      181 gcgagccaat caaaatgtat tatctagact gcccaaagga gtggttcact cctatatcaa
      241 aaccgagcat tacttgatac gacggacgat acagggatgt aggaggatta taatccaaag
      301 agactggccg ctggtgcgaa gacggattca ttttcaaaga gccggagcca tgggcaatat
      361 gattccgagt gttatggatt cgggggttct gctaggacgg tggaatcgta gggctaaggc
      421 tagtttccat atggattgga tacgccgcca cgaattggtt gaggttccag aagatccaga
      481 cgaggtagaa tatttagaag aatcctggga aagcgaagag gagcctgaat cctcttccac
      541 ctctggttac agttcacgtc caagatccga agaaattccc agtgaaatgg atgtggatta
      601 accccagtag ctcgagaatt tatatataat cgatgaggct gggaatacag atagctcgcc
      661 cagccaacct attatgcgat caagagcaga agttgggatg ttgaatcctt gctgtgttat
      721 aaagattccg cccaggagta aatttcaaat tgagtgccaa ttcaattgga gcaacgtaat
      781 acatgtcaaa cagattataa aattgtatta aagtcttagg tccctattca aaatgtaa