Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139656 838 bp mRNA linear INV 09-DEC-2024 (LOC108056045), mRNA. ACCESSION XM_017139656 VERSION XM_017139656.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139656.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..838 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..838 /gene="LOC108056045" /note="uncharacterized LOC108056045; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108056045" CDS 119..601 /gene="LOC108056045" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016995145.2" /db_xref="GeneID:108056045" /translation="MVKIRPNSVKMPQHAHGIGNRRANQNVLSRLPKGVVHSYIKTEH YLIRRTIQGCRRIIIQRDWPLVRRRIHFQRAGAMGNMIPSVMDSGVLLGRWNRRAKAS FHMDWIRRHELVEVPEDPDEVEYLEESWESEEEPESSSTSGYSSRPRSEEIPSEMDVD " polyA_site 838 /gene="LOC108056045" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaataatcag tacaactata caaactcaac tgaaaacacc acacaccaca cagtattacc 61 tagaatattt ttttgtcgtg ttttttttag tcaacgaaga ttttcgattt cgataaaaat 121 ggtcaaaatt cggcccaatt cggtcaagat gccccaacat gctcatggaa taggcaacag 181 gcgagccaat caaaatgtat tatctagact gcccaaagga gtggttcact cctatatcaa 241 aaccgagcat tacttgatac gacggacgat acagggatgt aggaggatta taatccaaag 301 agactggccg ctggtgcgaa gacggattca ttttcaaaga gccggagcca tgggcaatat 361 gattccgagt gttatggatt cgggggttct gctaggacgg tggaatcgta gggctaaggc 421 tagtttccat atggattgga tacgccgcca cgaattggtt gaggttccag aagatccaga 481 cgaggtagaa tatttagaag aatcctggga aagcgaagag gagcctgaat cctcttccac 541 ctctggttac agttcacgtc caagatccga agaaattccc agtgaaatgg atgtggatta 601 accccagtag ctcgagaatt tatatataat cgatgaggct gggaatacag atagctcgcc 661 cagccaacct attatgcgat caagagcaga agttgggatg ttgaatcctt gctgtgttat 721 aaagattccg cccaggagta aatttcaaat tgagtgccaa ttcaattgga gcaacgtaat 781 acatgtcaaa cagattataa aattgtatta aagtcttagg tccctattca aaatgtaa