Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH:ubiquinone oxidoreductase


LOCUS       XM_017139654             478 bp    mRNA    linear   INV 09-DEC-2024
            subunit V3 (NdufV3), mRNA.
ACCESSION   XM_017139654
VERSION     XM_017139654.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017139654.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..478
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..478
                     /gene="NdufV3"
                     /note="NADH:ubiquinone oxidoreductase subunit V3; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056043"
     CDS             90..410
                     /gene="NdufV3"
                     /codon_start=1
                     /product="uncharacterized protein NdufV3"
                     /protein_id="XP_016995143.2"
                     /db_xref="GeneID:108056043"
                     /translation="MFSPTRALRPALSRCYSQIKGGPSASAPGSKAPGTGAASAGGGP
                     SSPAVVGLTSNCVRPTSEPVGPGASATSGYKVPEYYCFNRFSYAEAEVEMAKYRCPQP
                     SALK"
     misc_feature    300..401
                     /gene="NdufV3"
                     /note="NADH dehydrogenase [ubiquinone] flavoprotein 3,
                     mitochondrial; Region: NDUFV3; pfam15880"
                     /db_xref="CDD:464921"
     polyA_site      478
                     /gene="NdufV3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgcccgact tttgacgttg cccaacacag gtccattgtt gatacctgat tacgtgaatt
       61 atttttgcaa attaaaagct agactagtca tgttctcgcc cacgcgtgcc ctgcgcccgg
      121 ccctgagccg ctgctacagc cagatcaagg gcggacccag tgccagtgcc cccggatcga
      181 aggccccagg aacgggagcc gcatccgcag gaggcggccc atcctcgcca gccgtcgtgg
      241 gactgaccag caactgcgta aggcccacca gcgagcccgt gggacccggc gcatccgcca
      301 cttcgggcta caaggtgccc gagtactact gcttcaaccg cttcagctac gccgaggcgg
      361 aggtggagat ggccaagtac cgctgcccgc agccctcggc cttgaagtag acaccccagc
      421 caattggaaa caaattgtta atgttaaata aatagtaaaa aggagttcag aaatcatc