Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017139654 478 bp mRNA linear INV 09-DEC-2024 subunit V3 (NdufV3), mRNA. ACCESSION XM_017139654 VERSION XM_017139654.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017139654.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..478 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..478 /gene="NdufV3" /note="NADH:ubiquinone oxidoreductase subunit V3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056043" CDS 90..410 /gene="NdufV3" /codon_start=1 /product="uncharacterized protein NdufV3" /protein_id="XP_016995143.2" /db_xref="GeneID:108056043" /translation="MFSPTRALRPALSRCYSQIKGGPSASAPGSKAPGTGAASAGGGP SSPAVVGLTSNCVRPTSEPVGPGASATSGYKVPEYYCFNRFSYAEAEVEMAKYRCPQP SALK" misc_feature 300..401 /gene="NdufV3" /note="NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial; Region: NDUFV3; pfam15880" /db_xref="CDD:464921" polyA_site 478 /gene="NdufV3" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgcccgact tttgacgttg cccaacacag gtccattgtt gatacctgat tacgtgaatt 61 atttttgcaa attaaaagct agactagtca tgttctcgcc cacgcgtgcc ctgcgcccgg 121 ccctgagccg ctgctacagc cagatcaagg gcggacccag tgccagtgcc cccggatcga 181 aggccccagg aacgggagcc gcatccgcag gaggcggccc atcctcgcca gccgtcgtgg 241 gactgaccag caactgcgta aggcccacca gcgagcccgt gggacccggc gcatccgcca 301 cttcgggcta caaggtgccc gagtactact gcttcaaccg cttcagctac gccgaggcgg 361 aggtggagat ggccaagtac cgctgcccgc agccctcggc cttgaagtag acaccccagc 421 caattggaaa caaattgtta atgttaaata aatagtaaaa aggagttcag aaatcatc